KEGG   Saccharomyces cerevisiae (budding yeast): YKR082W
Entry
YKR082W           CDS       T00005                                 

Gene name
NUP133, RAT3
Definition
(RefSeq) Nup133p
  KO
K14300  nuclear pore complex protein Nup133
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YKR082W (NUP133)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YKR082W (NUP133)
   03036 Chromosome and associated proteins [BR:sce03036]
    YKR082W (NUP133)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YKR082W (NUP133)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YKR082W (NUP133)
SSDB
Motif
Pfam: Nucleoporin_N
Other DBs
NCBI-GeneID: 853957
NCBI-ProteinID: NP_013008
SGD: S000001790
UniProt: P36161
Structure
PDB: 
3KFO

Position
XI:592825..596298
AA seq 1157 aa
MSEKKVHLRLRKELSVPIAVVENESLAQLSYEEESQASLMDISMEQQQLRLHSHFDNSKV
FTENNRYIVKTLQTDYSSGFSNDDELNGYIDMQIGYGLVNDHKKVYIWNIHSTQKDTPYI
TVPFRSDDNDEIAVAPRCILTFPATMDESPLALNPNDQDETGGLIIIKGSKAIYYEDINS
INNLNFKLSEKFSHELELPINSSGGEKCDLMLNCEPAGIVLSTNMGRIFFITIRNSMGKP
QLKLGKLLNKPFKLGIWSKIFNTNSSVVSLRNGPILGKGTRLVYITTNKGIFQTWQLSAT
NSHPTKLIDVNIYEAILESLQDLYPFAHGTLKIWDSHPLQDESSQLFLSSIYDSSCNETY
YILSTIIFDSSSNSFTIFSTYRLNTFMESITDTKFKPKIFIPQMENANDTNEVTSILVMF
PNAVVITQVNSKLDSSYSMRRKWEDIVSLRNDIDIIGSGYDSKSLYVLTKQMGVLQFFVK
ENEETNSKPEVGFVKSHVDQAVYFSKINANPIDFNLPPEISLDQESIEHDLKLTSEEIFH
SNGKYIPPMLNTLGQHLSVRKEFFQNFLTFVAKNFNYKISPELKLDLIEKFEILNCCIKF
NSIIRQSDVLNDIWEKTLSNYNLTQNEHLTTKTVVINSPDVFPVIFKQFLNHVVFVLFPS
QNQNFKLNVTNLINLCFYDGILEEGEKTIRYELLELDPMEVDTSKLPWFINFDYLNCINQ
CFFDFTFACEEEGSLDSYKEGLLKIVKILYYQFNQFKIWINTQPVKSVNANDNFININNL
YDDNHLDWNHVLCKVNLKEQCIQIAEFYKDLSGLVQTLQTLDQNDSTTVSLYETFFNEFP
KEFSFTLFEYLIKHKKLNDLIFRFPQQHDVLIQFFQESAPKYGHVAWIQQILDGSYADAM
NTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLDINTLRKIQYNLDTIDAEKNI
SNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLSDLVELYSMLDDEESLFIPLR
LLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQHIVKRVFDEELPKNNDFPLPS
VDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEISQVETLNSDNSLEIKLHSTIGSV
AKEKNYTINYETNTVEY
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgagtgaaaaaaaagtacatcttcgtttgcggaaggaacttagcgtacccattgcggtg
gttgaaaacgaatccctggcgcagttgtcttatgaagaggaaagccaggcctctctaatg
gacatttccatggagcagcaacagttaaggttacattcgcactttgataattccaaggtt
ttcacagaaaataacagatacatagtaaaaacccttcaaacagactacagtagcggattc
agtaacgatgacgaattgaatggatatatcgatatgcaaattggatatggactagtcaat
gaccacaagaaggtttacatctggaatattcactccactcaaaaggatacgccctatata
actgtaccatttcgttctgatgataatgatgaaatagcagtcgcgcccaggtgcatacta
actttccctgctacaatggatgagtctccattagcactgaatcctaatgatcaggacgaa
accggagggcttatcattatcaaaggtagcaaagcgatatattatgaggatatcaactcc
ataaataatttgaactttaagttatctgaaaaattctctcacgagttagaattacccatc
aactcttcgggcggagagaagtgtgacctaatgttaaactgcgaacctgctggtatagtg
ctttctacaaatatgggcagaatattttttataaccattagaaattccatgggtaaacct
caactgaagttaggcaaactattaaataaacctttcaaattgggtatctggtccaaaatt
ttcaatacaaacagttcagttgtctcattacgaaatggacctatcctcggtaaggggaca
aggttagtatatattactactaacaaaggaatttttcaaacatggcagttgtctgccacg
aattcccatccaacaaaattgattgatgtaaacatttacgaagccattttagagtcgctc
caggatttgtatccatttgctcatggtacgttgaagatttgggactctcatccattacaa
gatgaaagttcacaacttttcctgtcatctatttacgacagttcatgcaatgaaacatat
tatattctttccacgattatcttcgattcttcttctaatagttttactattttttccact
tatagattgaacacttttatggagtcaataaccgacacaaagtttaagcctaagatattt
atacctcagatggagaatgctaacgataccaatgaggtaacttccattttggtaatgttc
cccaatgctgttgtcattactcaggtgaactcaaaattggactctagctattcaatgaga
agaaagtgggaagatattgttagccttagaaatgacattgatataattggttctggttac
gactcaaaatctttgtatgttttaacgaaacaaatgggggtgctacagttttttgtgaaa
gagaatgaggaaacaaattctaaaccggaagttgggtttgtcaaatctcatgttgatcaa
gctgtttatttctccaaaataaatgcaaatcccatagatttcaatttacctccagaaatt
tcactagatcaagaatctatagagcatgatttaaaattaaccagcgaggagatttttcat
tccaacggcaagtacataccccctatgctaaatacgttggggcaacatctctctgtccgt
aaagaattttttcaaaatttcctgacatttgttgctaagaacttcaactataaaatatca
cccgaactgaaattggatctgatcgaaaaatttgagatcttgaattgctgtattaagttc
aatagtatcatcagacaatctgatgtattgaacgatatatgggagaagactttatcaaac
tataatctgacacaaaatgaacacttaactactaaaacagttgtaatcaacagtcccgac
gtatttccagtaatctttaaacaatttttaaaccatgttgtgtttgttttgttcccatca
caaaatcaaaatttcaaactaaatgttaccaatttaatcaacttatgcttttatgatgga
attcttgaagaaggtgaaaaaactataaggtatgaacttttggagttagacccgatggag
gttgatacatccaagctaccatggttcataaactttgattacttaaactgtatcaatcaa
tgtttttttgattttacatttgcgtgtgaggaggaaggaagtctggattcttataaagag
ggcttgttaaagattgtgaaaattttatattatcagttcaaccaatttaaaatatggatc
aacacgcaacccgttaaatctgtgaacgccaatgataattttataaatatcaacaatctt
tatgatgataaccacctggattggaaccacgtcctttgtaaggtaaatctaaaagaacag
tgtattcaaatagcagaattttacaaagatttatctggattggtgcaaacattacaaact
ttagatcaaaatgactcaacaaccgtatcgctatacgaaacattcttcaacgaattccct
aaagagtttagctttacattatttgaatatttaatcaagcataaaaaattgaacgacctc
atcttcaggttcccacaacaacacgatgttttaatacagtttttccaagagtccgctcca
aagtacggtcatgtagcatggatccaacagattctggatgggtcgtacgcagatgccatg
aatactttaaaaaacattactgttgatgattcaaagaagggcgaaagcttgagcgaatgt
gaattgcacttgaatgttgcaaaattaagctcgttgctagttgaaaaggataatttggac
attaatactttgagaaagatccaatataatttagatacaattgatgctgagaaaaatatt
tcaaacaaattgaaaaagggcgaagttcagatatgtaaacgcttcaagaatggctctatc
agggaagttttcaacatattagtggaagagcttaaatcaacaacagtagtcaatctatcg
gatctcgttgagttgtattctatgctcgacgatgaagagagcttattcataccgctaagg
cttctttctgttgatggaaacttactgaattttgaagttaaaaagttcttgaatgctttg
gtatggagaagaatcgttctactaaatgctagtaatgaaggagataaactgcttcagcat
atagtcaaacgtgtttttgatgaagaactacccaaaaataatgatttccccttgcccagt
gtggatcttttatgtgacaaatcgttactgacgccagaatacataagcgaaacatatggc
aggtttcctattgatcagaatgccatacgtgaagagatatatgaagaaatatctcaagtg
gaaacgttgaactcagacaactcactcgagataaagttgcactcgactattggttctgta
gcgaaagaaaaaaactataccatcaactatgaaaccaacactgtagaatactaa

DBGET integrated database retrieval system