KEGG   Saccharomyces cerevisiae (budding yeast): YLR208W
Entry
YLR208W           CDS       T00005                                 

Gene name
SEC13, ANU3
Definition
(RefSeq) GTPase-activating protein SEC13
  KO
K14004  protein transport protein SEC13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YLR208W (SEC13)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YLR208W (SEC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YLR208W (SEC13)
   04131 Membrane trafficking [BR:sce04131]
    YLR208W (SEC13)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YLR208W (SEC13)
Membrane trafficking [BR:sce04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    YLR208W (SEC13)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    YLR208W (SEC13)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 850905
NCBI-ProteinID: NP_013309
SGD: S000004198
UniProt: Q04491
Structure
PDB: 

Position
XII:559551..560444
AA seq 297 aa
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS
SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
NT seq 894 nt   +upstreamnt  +downstreamnt
atggtcgtcatagctaatgcgcacaacgaattaatccatgacgctgttctagactattat
gggaagcgccttgcaacctgctcttctgacaagacaatcaagatctttgaagtcgaagga
gaaacacacaagttaatagacacgttgactggccacgaaggcccagtttggcgtgttgat
tgggcacatcctaaattcggaaccattttggcatcgtgttcttatgatggtaaagtgttg
atttggaaggaagaaaacggtagatggtctcaaattgccgttcatgctgtccactctgct
tctgtcaactctgttcaatgggctcctcatgaatatggccccctactgctggttgcttcc
tctgatggtaaggtctccgtagtagagttcaaagaaaacggtactacttccccaataatc
atcgatgctcatgccattggcgttaactctgcttcttgggctccagctaccatcgaagaa
gatggtgaacacaacggtactaaagaatctcgcaagtttgttactgggggtgctgacaat
ttggtaaagatttggaagtacaattcagatgcccaaacttatgttctggaaagcacctta
gaaggtcacagcgattgggttagagacgtagcatggtcacctactgttcttctacgttct
tatttggccagtgtttctcaagatcgcacctgtattatttggactcaagacaatgaacaa
ggcccatggaaaaaaactttattaaaagaagaaaaattcccagatgttttatggagagcc
agttggtctttgtcaggtaatgtactagctctttccggtggcgataataaagttacttta
tggaaggaaaatcttgagggtaaatgggaacccgctggtgaagttcatcagtga

DBGET integrated database retrieval system