KEGG   Saccharomyces cerevisiae (budding yeast): YLR262C
Entry
YLR262C           CDS       T00005                                 

Symbol
YPT6
Name
(RefSeq) Rab family GTPase YPT6
  KO
K07893  Ras-related protein Rab-6A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLR262C (YPT6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YLR262C (YPT6)
   04031 GTP-binding proteins [BR:sce04031]
    YLR262C (YPT6)
Membrane trafficking [BR:sce04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    YLR262C (YPT6)
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
    YLR262C (YPT6)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YLR262C (YPT6)
  Exosomal proteins of bladder cancer cells
   YLR262C (YPT6)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    YLR262C (YPT6)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 SRPRB Gtr1_RagA GTP_EFTU ATPase_2 PduV-EutP AAA_7 AAA_24 AAA_22 AAA_16 ResIII NACHT
Other DBs
NCBI-GeneID: 850966
NCBI-ProteinID: NP_013363
SGD: S000004252
UniProt: Q99260
Position
XII:complement(668244..668891)
AA seq 215 aa
MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIR
LQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILC
IVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSE
STPLDSENANSANQNKPGVIDISTAEEQEQSACQC
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagcagatccgggaaatcattgacaaagtacaaaattgtttttttgggagaacagggt
gttggaaaaacatcgctgatcactagatttatgtatgatacgttcgatgatcattaccaa
gccacgattggtatagattttctttccaagaccatgtatttggatgataagacaattaga
ttacagttatgggatacagcaggtcaggaaagatttagatcattaataccttcatatatc
agagattcgagagttgctattatcgtttacgacattacgaagagaaaatcatttgaatat
attgataaatggatagaagacgttaaaaatgaaagaggtgacgaaaatgttatattgtgc
attgttggtaacaaaagtgatttatcagatgaaaggcaaatctcaaccgaagagggagag
aaaaaagcaaaactattgggtgctaaaatctttatggaaacgtccacaaaggcaggctat
aatgtcaaagctttattcaaaaagattgccaaatcgctgcctgaatttcaaaacagcgag
tcaactcctttggatagcgaaaatgcaaatagtgcaaaccaaaataaaccgggagtcatt
gatatttctacagcagaggagcaggaacaaagcgcttgtcagtgttag

DBGET integrated database retrieval system