KEGG   Saccharomyces cerevisiae (budding yeast): YLR262C-A
Entry
YLR262C-A         CDS       T00005                                 

Symbol
TMA7
Name
(RefSeq) Tma7p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: TMA7 DUF5633
Other DBs
NCBI-GeneID: 850967
NCBI-ProteinID: NP_013364
SGD: S000007246
UniProt: Q3E764
Position
XII:complement(669468..669662)
AA seq 64 aa
MSSRQGGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKSGKPLVGGGIKK
SGKK
NT seq 195 nt   +upstreamnt  +downstreamnt
atgtctagtcgccaaggtggtaagatgaagcctctaaagcaaaagaagaagcaacaacag
gacttagatcctgaagacattgccttcaaagagaagcaaaaggccgatgctgctgctaag
aaagctttgatggctaatatgaaaagtggtaaacctttagtgggtggtggtatcaaaaaa
tctggtaagaaataa

DBGET integrated database retrieval system