KEGG   Saccharomyces cerevisiae (budding yeast): YLR293C
Entry
YLR293C           CDS       T00005                                 

Gene name
GSP1, CNR1, CST17
Definition
(RefSeq) Ran GTPase GSP1
  KO
K07936  GTP-binding nuclear protein Ran
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YLR293C (GSP1)
   03008 Ribosome biogenesis in eukaryotes
    YLR293C (GSP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YLR293C (GSP1)
   03009 Ribosome biogenesis [BR:sce03009]
    YLR293C (GSP1)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YLR293C (GSP1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR293C (GSP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YLR293C (GSP1)
   04031 GTP-binding proteins [BR:sce04031]
    YLR293C (GSP1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     YLR293C (GSP1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    YLR293C (GSP1)
  Pre-60S particles
    YLR293C (GSP1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    YLR293C (GSP1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     YLR293C (GSP1)
   Spindle formation proteins
    YLR293C (GSP1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YLR293C (GSP1)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Ran Family
   Ran
    YLR293C (GSP1)
SSDB
Motif
Pfam: Ras Roc Arf RNA_helicase MMR_HSR1 GTP_EFTU Gtr1_RagA SRPRB ATPase Pox_A32 ArgoMid AAA_7 AAA_33 AAA_24 TsaE AAA_16 Septin
Other DBs
NCBI-GeneID: 851000
NCBI-ProteinID: NP_013396
SGD: S000004284
UniProt: P32835
Structure
PDB: 

Position
XII:complement(720771..721430)
AA seq 219 aa
MSAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE
IKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIV
LCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVA
SPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtctgccccagctgctaacggtgaagttccaacattcaaactagttcttgtcggtgat
ggtggtactggtaagaccacttttgtcaagagacatttgaccggtgaattcgaaaagaag
tacatcgccaccattggtgtcgaagtgcatcctttatccttttacaccaacttcggtgaa
attaaatttgatgtctgggatactgccggccaagaaaaattcggtggtttaagagacggt
tactacattaacgcccaatgtgccatcatcatgttcgatgttacttccagaattacttac
aagaacgttccaaactggcacagggatttagtccgtgtttgtgaaaacatcccaattgtc
ttgtgtggtaacaaggtcgatgtcaaagaaagaaaggtcaaggccaagactatcactttc
cacagaaagaaaaacttgcaatactacgatatttctgccaagtccaactacaactttgaa
aagcctttcttatggttggccagaaaattggctggtaacccacaattagaatttgttgct
tctccagctttagccccaccagaagtccaagtcgatgaacaattgatgcaacaataccaa
caagaaatggaacaagctactgctttgccattgcctgatgaagatgatgctgatttataa

KEGG   Saccharomyces cerevisiae (budding yeast): YOR185C
Entry
YOR185C           CDS       T00005                                 

Gene name
GSP2, CNR2
Definition
(RefSeq) Ran GTPase GSP2
  KO
K07936  GTP-binding nuclear protein Ran
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YOR185C (GSP2)
   03008 Ribosome biogenesis in eukaryotes
    YOR185C (GSP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YOR185C (GSP2)
   03009 Ribosome biogenesis [BR:sce03009]
    YOR185C (GSP2)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YOR185C (GSP2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YOR185C (GSP2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YOR185C (GSP2)
   04031 GTP-binding proteins [BR:sce04031]
    YOR185C (GSP2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     YOR185C (GSP2)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    YOR185C (GSP2)
  Pre-60S particles
    YOR185C (GSP2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    YOR185C (GSP2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     YOR185C (GSP2)
   Spindle formation proteins
    YOR185C (GSP2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YOR185C (GSP2)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Ran Family
   Ran
    YOR185C (GSP2)
SSDB
Motif
Pfam: Ras Roc Arf RNA_helicase MMR_HSR1 GTP_EFTU Gtr1_RagA G-alpha Pox_A32 SRPRB ArgoMid ATPase AAA_7 TsaE AAA_24 AAA_33 AAA_16 DUF815
Other DBs
NCBI-GeneID: 854357
NCBI-ProteinID: NP_014828
SGD: S000005711
UniProt: P32836
Structure
PDB: 
3ICQ

Position
XV:complement(681444..682106)
AA seq 220 aa
MSAPAQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG
EIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPI
VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
ASPALAPPEVQVDEQLMHQYQQEMDQATALPLPDEDDADL
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtcagcacctgctcaaaacaatgccgaggttcccactttcaagttagttcttgttggt
gatggaggtactggtaagactacctttgtgaagagacatctgaccggtgaatttgaaaaa
aaatacattgcaactatcggagtagaagttcatcctctatctttttatactaatttcggt
gaaattaagttcgatgtctgggataccgcaggccaagaaaaatttggcgggttaagggat
ggttattacatcaatgctcaatgtgcaattattatgttcgatgtcacatccagaatcact
tacaagaacgtccctaattggcatagagacttagtccgtgtgtgtgaaaatattcccata
gtgctatgtggcaataaagtcgatgtcaaagagagaaaggtcaaggccaagactatcact
ttccatagaaaaaagaacttacaatattatgacatttctgcaaaatccaattataatttt
gaaaagcctttcttgtggttggctagaaaacttgccggtaacccacaattggagtttgtt
gcgtctcctgcattggccccacctgaggtgcaagttgacgagcaactaatgcaccaatac
cagcaagaaatggaccaagccactgctttaccattacctgatgaagacgatgctgattta
taa

DBGET integrated database retrieval system