KEGG   Saccharomyces cerevisiae (budding yeast): YLR347C
Entry
YLR347C           CDS       T00005                                 

Gene name
KAP95, RSL1
Definition
(RefSeq) karyopherin beta
  KO
K14293  importin subunit beta-1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YLR347C (KAP95)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YLR347C (KAP95)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR347C (KAP95)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    YLR347C (KAP95)
  Pre-60S particles
    YLR347C (KAP95)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YLR347C (KAP95)
SSDB
Motif
Pfam: HEAT IBN_N HEAT_EZ Cnd1 HEAT_2 DUF3385 Arm DUF3347
Other DBs
NCBI-GeneID: 851061
NCBI-ProteinID: NP_013451
SGD: S000004339
UniProt: Q06142
Structure
PDB: 
5OWU 3ND2 3EA5 2BKU

Position
XII:complement(823828..826413)
AA seq 861 aa
MSTAEFAQLLENSILSPDQNIRLTSETQLKKLSNDNFLQFAGLSSQVLIDENTKLEGRIL
AALTLKNELVSKDSVKTQQFAQRWITQVSPEAKNQIKTNALTALVSIEPRIANAAAQLIA
AIADIELPHGAWPELMKIMVDNTGAEQPENVKRASLLALGYMCESADPQSQALVSSSNNI
LIAIVQGAQSTETSKAVRLAALNALADSLIFIKNNMEREGERNYLMQVVCEATQAEDIEV
QAAAFGCLCKIMSLYYTFMKPYMEQALYALTIATMKSPNDKVASMTVEFWSTICEEEIDI
AYELAQFPQSPLQSYNFALSSIKDVVPNLLNLLTRQNEDPEDDDWNVSMSAGACLQLFAQ
NCGNHILEPVLEFVEQNITADNWRNREAAVMAFGSIMDGPDKVQRTYYVHQALPSILNLM
NDQSLQVKETTAWCIGRIADSVAESIDPQQHLPGVVQACLIGLQDHPKVATNCSWTIINL
VEQLAEATPSPIYNFYPALVDGLIGAANRIDNEFNARASAFSALTTMVEYATDTVAETSA
SISTFVMDKLGQTMSVDENQLTLEDAQSLQELQSNILTVLAAVIRKSPSSVEPVADMLMG
LFFRLLEKKDSAFIEDDVFYAISALAASLGKGFEKYLETFSPYLLKALNQVDSPVSITAV
GFIADISNSLEEDFRRYSDAMMNVLAQMISNPNARRELKPAVLSVFGDIASNIGADFIPY
LNDIMALCVAAQNTKPENGTLEALDYQIKVLEAVLDAYVGIVAGLHDKPEALFPYVGTIF
QFIAQVAEDPQLYSEDATSRAAVGLIGDIAAMFPDGSIKQFYGQDWVIDYIKRTRSGQLF
SQATKDTARWAREQQKRQLSL
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgtccaccgctgaatttgctcaactattggagaacagtatcttaagtcccgaccaaaac
attcggttgactagtgaaacgcaattaaagaaattatctaatgacaacttcttacaattt
gcaggtctttcttcgcaagtgcttatcgatgaaaatacaaagctagaagggcgtattcta
gcggcgctaactttgaagaacgagctggtgtccaaggactcagtcaagacgcagcaattt
gcacaacgttggattacacaggttagtccagaagctaaaaaccaaattaaaactaacgcg
ctgaccgcattggtctccatagaaccgcgtatagcaaatgcagcagctcaattgattgcg
gctatagcagatattgagttgccccatggcgcatggccagagttgatgaaaattatggtt
gacaatacaggtgcggaacaaccagaaaatgtcaagagagcctctttattggccttgggt
tatatgtgtgaaagtgcagaccctcaaagtcaagccttagtttcttcatcaaacaatatc
ttaatcgctattgtccagggtgcgcaatctacggaaacttccaaagcagtcagactggca
gctctgaatgctcttgcagactctttaattttcatcaaaaataacatggaacgcgaaggt
gaaagaaactaccttatgcaagtcgtctgtgaagccactcaagctgaagatatagaagtt
caagcagctgcctttggttgtttgtgtaaaatcatgtcactatactatacatttatgaaa
ccttacatggagcaagccctatatgcattgaccatagctacaatgaaatctccaaatgat
aaagtagcttccatgactgtggaattctggtccactatttgtgaagaagaaatcgatatt
gcctatgagctcgctcaatttcctcaatctcctttacagagttataatttcgctctctct
tctattaaagatgttgtccccaatttgttgaaccttctaacgagacaaaatgaagatcca
gaagatgacgattggaatgtttccatgtccgcaggtgcatgcttgcagttgtttgcccaa
aactgtggcaatcatatcttagaacctgtattggaatttgttgaacaaaatattaccgct
gacaactggaggaatcgtgaagctgctgtaatggcctttggttccattatggatggccct
gataaggtccaaagaacctattacgttcaccaagccttaccatctattttgaatttaatg
aacgatcaatccctacaagttaaggaaaccactgcttggtgtattggtagaattgctgat
tctgttgctgaatctatcgacccacaacagcatcttccaggtgtcgttcaagcttgttta
attgggttgcaagatcacccaaaagtggccacaaactgttcttggaccattatcaactta
gtcgaacaattagcagaagccacaccatctccaatctataacttctatcccgctcttgta
gatggtttgatcggtgctgcaaatagaattgataatgagttcaatgcccgtgcatccgcc
ttttcagccttgacaacaatggttgaatacgccacggacacggtagctgaaacttccgcc
tccatttctacgtttgttatggacaaattagggcagacaatgagtgttgatgaaaatcaa
ttaacgttagaagatgcgcaaagtttgcaagaattgcagtcaaatatattgactgttcta
gcagccgttattagaaaaagtccaagtagtgtagaaccggttgcagatatgcttatggga
ctgttcttcaggttgttggaaaaaaaggactctgcgtttattgaagacgatgtgttttat
gctatttcagctctagctgcttctttgggtaaaggatttgagaaatacctggaaacattt
tctccctatttattaaaggctttaaatcaagtagattcgccagtttcaatcaccgcagtg
ggcttcatcgctgatatttcaaattcgttagaagaagatttcagaagatattccgatgct
atgatgaatgtcttggctcaaatgatctctaatccaaatgcaaggagagagttgaaacca
gccgtcttgagcgtgttcggtgatattgcttccaatataggtgctgattttattccctac
ttgaatgacatcatggcgttgtgtgttgctgcccaaaacacgaagccggaaaacggcaca
ttagaagcccttgattatcaaataaaagtactagaagcagtactagatgcttatgtgggt
atagtagcgggtcttcatgataaacctgaagctctgttcccttatgttggtactatattc
cagttcattgcacaagttgcagaagatcctcagctgtacagtgaggatgctacctcaaga
gcagcagtcggattgattggtgatatagcagcgatgtttccagacggctcaatcaaacaa
ttttatggacaagactgggttattgattacattaaaagaactaggagtggccaattgttc
agtcaagccacaaaagatacagcaagatgggctagagagcaacagaagcgtcaattatcc
ttataa

DBGET integrated database retrieval system