KEGG   Saccharomyces cerevisiae (budding yeast): YML103C
Entry
YML103C           CDS       T00005                                 

Gene name
NUP188
Definition
(RefSeq) Nup188p
  KO
K14311  nuclear pore complex protein Nup188
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YML103C (NUP188)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YML103C (NUP188)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YML103C (NUP188)
SSDB
Motif
Pfam: Nup188 Nup188_C SUIM_assoc
Other DBs
NCBI-GeneID: 854868
NCBI-ProteinID: NP_013604
SGD: S000004571
UniProt: P52593
Position
XIII:complement(62582..67549)
AA seq 1655 aa
MATPSFGNSSPQLTFTHVANFMNDAAADVSAVDAKQLAQIRQFLKANKTNLIESLNTIRQ
NVTSSGDHNKLRSTIANLLQINVDNDPFFAQSEDLSHAVEFFMSERSSRLHIVYSLLVNP
DIDLETYSFIDNDRFNVVGKLISIISSVIQNYDIITASSLAHDYNNDQDMFTIVSLVQLK
KFSDLKFILQILQILNLMILNTKVPVDIVNQWFLQYQNQFVEFCRNINSTDKSIDTSSLQ
LYKFQNFQDLSYLSETLISRISSLFTITTILILGLNTSIAQFDIQSPLYMDTETFDTVNS
ALENDVATNIVNEDPIFHPMIHYSWSFILYYRRALQSSESFDDSDITKFALFAESHDVLQ
KLNTLSEILSFDPVYTTVITVFLEFSLNFIPITASTSRVFAKIISKAPEQFIENFLTNDT
FEKKLSIIKAKLPLLNESLIPLINLALIDTEFANFELKDICSFAVTKSSLNDLDYDLIAD
TITNSSSSSDIIVPDLIELKSDLLVAPPLENENSNCLLSIPKSTKGKILTIKQQQQQQQQ
QNGQQPPTTSNLIIFLYKFNGWSLVGRILQNLLHSYMEKGTQLDDLQHELMISIIKLVTN
VVDPKTSIEKSSEILSYLSNSLDTSASTINGASIIQVIFEIFEISLQRKDYTSIVQCCEF
MTMLTPNYLHLVSSYLNKSDLLDKYGKTGLSNMILGSVELSTGDYTFTIQLLKLTKVFIR
ESLSLKNIHISKRSKIDIINKLILHAIHIFESYYNWKYNNFLQKFEIAFHLTLIFYDVLH
DVFTINPHQKDQLIISSSANKLLQLFLTPMDSIDLAPNTLTNILISPLNTTTKILGDKIL
GNLYSKVMNNSFKLCTLLIAIRGSNRDLKPSNLEKLLFINSSKLVDVYTLPSYVHFKVQI
IELLSYLVEAPWNDDYPFLLSFLGEAKSMAFLKEVLSDLSSPVQDWNLLRSLYIFFTTLL
ESKQDGLSILFLTGQFASNKKINDESSIDKKSSILTVLQKNSLLLDSTPEEVSCKLLETI
TYVLNTWTNSKIFIKDPKFVNSLLAKLKDSKKLFQKKENLTRDETVSLIKKYKLISRIVE
IFALCIYNSTDSNSEILNFLNQEDLFELVHHFFQIDGFNKTFHDELNLKFKEKWPSLELQ
SFQKIPLSRINENENFGYDIPLLDIVLKADRSWNEPSKSQTNFKEEITDASLNLQYVNYE
ISTAKAWGALITTFVKRSTVPLNDGFVDLVEHFLKLNIDFGSDKQMFTQIYLERIELSFY
ILYSFKLSGKLLKEEKIIELMNKIFTIFKSGEIDFIKNIGKSLKNNFYRPLLRSVLVLLE
LVSSGDRFIELISDQLLEFFELVFSKGVYLILSEILCQINKCSTRGLSTDHTTQIVNLED
NTQDLLLLLSLFKKITNVNPSKNFNVILASSLNEVGTLKVILNLYSSAHLIRINDEPILG
QITLTFISELCSIEPIAAKLINSGLYSVLLESPLSVAIQQGDIKPEFSPRLHNIWSNGLL
SIVLLLLSQFGIKVLPETCLFVSYFGKQIKSTIYNWGDNKLAVSSSLIKETNQLVLLQKM
LNLLNYQELFIQPKNSDDQQEAVELVIGLDSEHDKKRLSAALSKFLTHPKYLNSRIIPTT
LEEQQQLEDESSRLEFVKGISRDIKALQDSLFKDV
NT seq 4968 nt   +upstreamnt  +downstreamnt
atggctacaccttcatttggcaattcctctccacaattgaccttcactcatgttgctaat
tttatgaacgatgctgctgctgatgtatccgctgtggatgccaagcaattggcccaaata
agacagtttttgaaagctaacaagacaaatcttatcgagagtctgaacacaataaggcag
aatgtaacttcttccggcgatcataacaagttacgctctacaattgcaaacttattgcaa
ataaacgtcgataatgatccattctttgctcaatctgaggacctttctcatgctgtagaa
ttctttatgtctgagagatcatctagacttcatatagtatactcacttctcgttaaccct
gacatcgacctcgagacatattcatttattgacaacgatagattcaatgtagtggggaaa
ttgatttctataatatcatctgtaatccagaactacgacattattacagcttcatcttta
gcacatgattataataacgatcaagacatgttcacaattgtctcattggtgcagttaaaa
aaattttctgatttgaagtttatcttgcagatattacaaattttgaatttaatgatcctc
aacacaaaagtaccagtagatatcgtcaatcaatggtttctacagtatcaaaatcaattt
gttgaattttgcagaaatataaattcaacagacaagagtatagatacctcgtcactacaa
ttgtacaagtttcagaatttccaagacctcagttacctctcagaaacgcttatttccagg
atttcatctttatttactatcacaactatattgatacttggactgaacacttcaatcgcg
caatttgatattcagtcacctttgtacatggatacagaaactttcgacaccgtcaatagc
gctctagagaatgatgtagcaaccaatatcgtcaacgaggaccccattttccatccaatg
attcattactcctggtcatttatactttattataggcgagcattacaatcgtcggaatca
tttgatgattcagacataacgaaatttgctctgtttgctgaatcacatgatgttcttcaa
aaattgaatactctctcagaaattctatcctttgatcctgtttacaccacagtaataaca
gtatttttggagttttctttaaattttattcctataactgcatctacttcccgggttttc
gccaagataatttcaaaggcaccagagcagttcattgagaatttcttaactaatgacact
tttgagaaaaaattgagcatcataaaggctaaattgcccctattgaacgaatcactgatc
ccgctaattaatttagccttaattgataccgagtttgccaattttgaattaaaagatata
tgttcatttgctgttaccaaaagtagtttgaacgatttggattatgacttaattgctgat
acaataacaaactcttcttcatcctccgatattatagtgcctgatttgatagagttgaag
tctgatttactagtggcgccacccttagaaaacgaaaactctaattgtctcttgtcaata
ccaaaatcaacaaagggaaaaattcttactatcaaacaacaacaacaacaacaacaacaa
cagaatggacaacagccgccaactacttccaatttgattattttcctttacaaattcaat
ggttggtctttggtgggtagaatattgcaaaatctattacattcatatatggaaaagggt
acacaactggatgacttacaacatgaattgatgatatccataataaagttagtcactaac
gttgtcgatccgaaaacctcgatcgagaaatctagtgaaattctgtcatatttatcaaat
tctctggatacttcagccagcaccataaatggagcgtcgattatccaagtaattttcgag
atttttgaaatatcactacaaagaaaagattatacctcaattgtacaatgttgtgaattt
atgactatgctgacaccgaattaccttcatcttgtttcttcttacttgaacaaatcggat
ttgttagacaaatatggtaagactggtctttccaatatgatactcggttcggttgaatta
tctacgggggattacacattcactatccaattgcttaagctaacaaaagtctttattcga
gaatctctctcattgaaaaatatccatatttccaagagaagtaaaattgatattattaat
aagttgattctacatgcaattcatatctttgagagttattacaactggaagtacaacaac
ttcttacaaaaattcgaaattgccttccatttgacattaattttttatgatgtacttcat
gacgttttcaccataaatccacatcaaaaggatcagttaatcatttcctcgtcagcaaac
aaattgttgcagttatttttgactcccatggattccattgatttggctccaaatactttg
acgaatattctgatttcaccattgaataccacaacaaaaattttaggcgacaaaattttg
ggtaatttatatagcaaggtaatgaataactccttcaagctgtgcacgcttttgatcgct
attcgaggtagcaatcgtgatttaaagccaagcaacctggaaaaattgcttttcataaat
tcatcaaaattggttgacgtttataccctaccaagttatgttcatttcaaagtgcagatc
atagagttgttaagctatttagtagaggctccttggaatgacgactatccatttctgtta
tctttccttggtgaagcaaagtcaatggcatttttgaaagaagtcctgtcggacctgagc
tctccagtgcaagattggaaccttctccgaagtttgtacattttttttactaccctatta
gaaagtaaacaagatgggttatctatcctcttcttaacaggtcaatttgcctccaataaa
aaaattaatgacgaatcctccatagacaaaaagagttctatattaactgttttgcaaaag
aattctttactattagattcaacgcctgaagaagtaagttgcaagttattagaaacgata
acatatgttttaaacacttggacaaattctaaaatattcataaaagatcctaaatttgtg
aattccttattggctaagttgaaggactcaaaaaaattatttcagaaaaaggaaaatttg
actcgtgacgaaactgtttctttgattaagaaatacaaattgatctcaaggattgtagaa
atatttgcgttgtgtatttacaactccactgattcaaactcggaaattttaaattttttg
aatcaggaagacttgtttgaattagttcatcatttcttccaaattgatgggttcaataaa
acttttcatgatgaattaaacttaaaatttaaagagaaatggcccagtttagagcttcag
tcgttccaaaaaattccattatccagaataaacgaaaatgagaatttcggttatgatatt
ccgttattagatatagttttaaaagctgaccgtagttggaacgaaccaagtaagagtcag
acaaattttaaggaggaaataacagacgcttcattaaatttgcagtatgtcaattacgaa
atatctaccgcaaaagcatggggcgcactaatcaccacgtttgtgaagaggagcactgtt
ccgttaaatgatggttttgtcgacttggtagagcatttcctcaagttaaatattgatttt
ggttcagataaacaaatgtttacccaaatatatctggaaagaattgagttgtcgttttac
attttatattcgttcaagttgtcgggaaaattgttgaaggaagaaaagataattgaattg
atgaacaagatttttacaattttcaaatctggtgagattgactttattaaaaatattggt
aagtcactaaaaaataacttttatagacctcttttgagatctgtcttagttcttctcgag
ttagtctcgtcaggagatcgttttatcgaattaatatctgatcaactactggaatttttt
gaattagtgtttagtaagggtgtttatttgatactgtctgagatattatgtcagatcaat
aaatgctccacgaggggtttaagcaccgatcacaccacccaaattgtcaacttggaggat
aatactcaggatttattgttattattatcactcttcaagaagatcaccaatgtgaatccc
tctaaaaacttcaatgttattctagcatcatccctaaacgaagtaggaactttgaaagtt
atactgaacctatattcaagcgcgcatttgataaggattaacgatgaaccaattcttggg
caaattactctgacctttatctccgaattgtgttctattgagccaattgctgcaaaactc
atcaacagtggattgtatagcgttctattggaaagtccactatctgttgcaatacagcaa
ggtgatataaaacctgaattttcgcctagattgcacaacatttggagcaatggtttgtta
tccattgttctactactattaagtcagttcggtatcaaggttttacctgagacgtgccta
tttgtttcatattttggaaaacaaataaaatctacaatatataactggggtgacaacaag
ttagcagtgtcaagttcgttgataaaggaaacgaatcaattggttttattgcaaaaaatg
ctaaacttgctaaattaccaagaattgtttattcagcctaaaaactctgatgatcaacaa
gaagctgtagaattggttattggtctagattctgaacatgataaaaaaaggttaagcgct
gcattaagcaagtttctaacacatccaaaatacttgaattcaagaataatacctacaact
ttagaagagcaacagcagttggaggatgaatcaagcagattggagttcgtcaagggtatc
agcagagacattaaagcattacaagattcactatttaaggacgtttaa

DBGET integrated database retrieval system