KEGG   Saccharomyces cerevisiae (budding yeast): YMR125W
Entry
YMR125W           CDS       T00005                                 

Gene name
STO1, CBC1, CBP80, GCR3, SUT1
Definition
(RefSeq) Sto1p
  KO
K12882  nuclear cap-binding protein subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YMR125W (STO1)
  09122 Translation
   03013 RNA transport
    YMR125W (STO1)
   03015 mRNA surveillance pathway
    YMR125W (STO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR125W (STO1)
   03041 Spliceosome [BR:sce03041]
    YMR125W (STO1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     YMR125W (STO1)
Spliceosome [BR:sce03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    YMR125W (STO1)
SSDB
Motif
Pfam: MIF4G_like MIF4G_like_2 MIF4G
Other DBs
NCBI-GeneID: 855155
NCBI-ProteinID: NP_013844
SGD: S000004732
UniProt: P34160
Structure
PDB: 
3UKY 6N7P

Position
XIII:join(517539..517563,517886..520446)
AA seq 861 aa
MFNRKRRGDFDEDENYRDFRPRMPKRQRIPPVVQLCKEMMPDIRTIGESVKAFEDDIKFL
SEAIMNEYGHEDYFNNALLSTLNAVVVEQPQKQAAIALLTMVVNSKNNVAGKSIINYFFE
ELQKWCKQTYNDEFKSTSNETGPWNKIKLILRFLSILSPMFLVDELINIYKSLFELSIEL
NNLDPGNRVPLSEAIYTNTLLNIPYLFFFNRNNDGLRTKVEELLAYVEQNYLVKTTDINL
LREYNGEPPYEMVELVRVVLPNVKKALINNLEQLNELFPDWNHLLTPQTGDEGFNDALTL
PSVDDLKSFVRLNKNFGSVDSMWKTPRYAFHVYLPNSAGNFETVVPISTYAGQLFNDIII
DLVESLEFNRKEVARQVITLDLFFKAGIFTEPGESIAQLIATYEENPLAPTFKIEDLAIE
TILGLIFKLPSVSQPFAYFYTLLVDICQNSPKAIAPVFGRAFRFFYSHLDSLDFELKLRY
LDWFSIQMSNFNFSWKWNEWEDDSIKFGKYFYNPKVNFAKNLIQKELRLTSNFSEVEDSL
PQEFTKYLDTSYIPRDQLINYYQSLFTGYTVEEDSVRKNDLYFRQEGVPMENTVRKILDY
THKANNSREVTELESILGELKNEYGSIISDFNRFVIILLVQAVTDSGSRSLSHANKYIND
LKEDLKTIFAKIELDIETKEYIIIEAVLTFWNANPQTGFLVADAFKYAGLLTSRTIFTFI
FNETGLKNNGLIEATAIEAVFRNLSQQISEENESGNNFEFVFERLCTIANSTIDLLDVNA
DEDIEIPKVNGEMDIDDIEDDKLDLKWKYFTVIGFIKSILRRYSHEYRELADKFIANIDN
AIPHESTRRTISNWIQETKEV
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgtttaatagaaaaagaagaggagacttcgatgaagatgaaaattaccgtgattttagg
cctcgcatgcctaaaagacagagaatcccacctgttgtacaactgtgtaaagaaatgatg
cccgatattcgcactattggtgaatctgttaaagcttttgaagatgatatcaaattcttg
agtgaagctataatgaatgagtatggccatgaggactactttaataatgctttactgagc
actttaaacgctgttgttgtggagcaaccacagaagcaagctgctatcgctctcttaacc
atggttgttaattcgaaaaataatgttgccggaaagagtattatcaattacttcttcgaa
gaattacaaaaatggtgcaagcaaacatataatgatgaattcaagagtacgtcaaatgaa
actgggccatggaacaagatcaagttaatcctgagatttttatccattctatcgcccatg
tttttagttgatgaactaatcaatatctacaagagcttatttgaattgagtatcgaatta
aacaatctggatccaggtaacagagttcctttatctgaagcaatttacaccaatacatta
ttaaatatcccgtatttgttcttttttaataggaataatgacggtttgaggacaaaagtg
gaggagttacttgcatacgttgaacaaaactatctagttaaaacaacggatataaaccta
ttaagagaatacaatggtgaacctccatatgaaatggtagaacttgtccgagtcgtatta
ccaaacgtcaagaaggcgctaatcaataacttggaacagctgaatgaattatttcctgat
tggaatcatttattaactccccaaaccggtgatgaagggttcaatgacgctttaaccctt
ccatcagtagatgatctaaagtctttcgtgcgcttgaataaaaactttggttcagttgat
agcatgtggaagacaccaaggtatgcttttcatgtttacttgccaaactccgctggtaat
ttcgaaacagttgtaccaatcagcacttatgctggtcaattattcaacgatatcattatt
gatctggtggaaagtttagaattcaatagaaaggaagtagctagacaagtgataactttg
gatctttttttcaaagcaggtatatttacagaacctggtgaatctattgcccaattaatt
gccacttatgaagagaacccattggctcctacatttaagatagaagatttggctattgaa
accattttgggacttatttttaaattacctagtgtttcccagccttttgcatacttttac
actttattggtggatatttgtcaaaattctccaaaagcaattgctcctgtctttggtaga
gcctttaggtttttttatagtcatttggattcattagattttgaactaaaattaagatat
ttggactggttttcaattcaaatgagcaactttaatttttcttggaagtggaatgaatgg
gaagacgattcgatcaaatttggcaagtatttttataatccaaaggtaaattttgctaaa
aatttgattcaaaaagaactacgattgacctctaacttttcagaagtagaggacagccta
ccacaagaattcacgaaatatttggatacttcttacattccaagagatcaactgattaac
tactatcaatcattattcaccggttatacggtagaagaagattccgttagaaaaaatgat
ctatattttagacaagaaggtgtacctatggaaaacacagtccgtaaaattttagattat
acccacaaagcaaacaattctagggaagttactgaattagaaagtattctaggtgagtta
aagaatgagtatggttccataatttccgactttaacagatttgttatcatattgttagtc
caggccgttacagactctggtagtagatctttatcacatgctaataaatatattaatgat
ttaaaagaagatctcaaaaccatatttgcgaagattgaattggatatcgagacaaaagag
tatatcataattgaagccgtcctaacattttggaacgccaaccctcagacaggtttctta
gtagcagatgcattcaaatatgcaggtttacttacttccagaaccatttttacatttata
tttaacgaaactggtttgaagaataatggtttgattgaagctacagcaattgaagcggtc
tttagaaatttatctcaacaaatctcggaagagaacgaaagtggaaataattttgagttc
gttttcgaaagattatgtaccatcgccaacagtactatagacttactagatgtcaatgct
gatgaagatattgagatacctaaagtcaacggggaaatggacatcgacgatattgaagat
gataaactggatttgaaatggaaatattttacagtgattgggtttattaaaagtatatta
agaaggtattcccacgaatatcgtgagttagcagacaaattcattgccaacattgataac
gctattccacacgaatccactaggagaacaatttcgaattggattcaagaaacaaaggaa
gtttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YPL178W
Entry
YPL178W           CDS       T00005                                 

Gene name
CBC2, CBP20, MUD13, SAE1
Definition
(RefSeq) nuclear cap-binding protein subunit CBC2
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YPL178W (CBC2)
  09122 Translation
   03013 RNA transport
    YPL178W (CBC2)
   03015 mRNA surveillance pathway
    YPL178W (CBC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YPL178W (CBC2)
   03041 Spliceosome [BR:sce03041]
    YPL178W (CBC2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     YPL178W (CBC2)
Spliceosome [BR:sce03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    YPL178W (CBC2)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 855925
NCBI-ProteinID: NP_015147
SGD: S000006099
UniProt: Q08920
Structure
PDB: 
6N7P

Position
XVI:212158..212784
AA seq 208 aa
MSLEEFDEVKYDHSTKRLDTPSRYLLRKARRNPNGLQELRESMKSSTIYVGNLSFYTSEE
QIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSDTKLDEKTITID
LDPGFEDGRQFGRGKSGGQVSDELRFDFDASRGGFAIPFAERVGVPHSRFDNSSSQSNTN
NYIPPPDAMGTFRPGFDEEREDDNYVPQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtccctggaagaatttgacgaagttaaatatgatcattcaactaaacgcctagataca
ccatcaaggtacctgctgcgcaaggctagaagaaaccctaacgggctacaagaactgcgt
gagtcgatgaagtcatccacaatttatgtaggaaatctttccttttatacatcagaagaa
caaatttacgaattattcagtaaatgtggcacaataaaaagaataattatgggtttggac
cgttttaagttcacgccatgtggcttctgttttattatatatagttgtccagatgaagca
ttgaatgccttaaaatatttgtccgatacaaagttagacgaaaagacaattaccattgat
ctagatcctggttttgaagatggaagacagtttggtcgtggtaagagcggtggtcaagtc
agcgatgaattgaggttcgattttgatgcatccagaggtggcttcgccattccatttgca
gagcgtgtcggcgtaccacattccagatttgataacagtagctcacaatctaatacgaat
aattatatccctcctcctgatgcaatgggtactttcagaccaggtttcgatgaagaaaga
gaagatgataactacgtacctcagtag

DBGET integrated database retrieval system