KEGG   Saccharomyces cerevisiae (budding yeast): YMR153W
Entry
YMR153W           CDS       T00005                                 

Gene name
NUP53
Definition
(RefSeq) FG-nucleoporin NUP53
  KO
K14313  nuclear pore complex protein Nup53
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YMR153W (NUP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR153W (NUP53)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YMR153W (NUP53)
SSDB
Motif
Pfam: Nup35_RRM Nup35_RRM_2
Other DBs
NCBI-GeneID: 855184
NCBI-ProteinID: NP_013873
SGD: S000004762
UniProt: Q03790
Structure
PDB: 
5UAZ 3W3Y

Position
XIII:564435..565862
AA seq 475 aa
MADLQKQENSSRFTNVSVIAPESQGQHEQQKQQEQLEQQKQPTGLLKGLNGFPSAPQPLF
MEDPPSTVSGELNDNPAWFNNPRKRAIPNSIIKRSNGQSLSPVRSDSADVPAFSNSNGFN
NVTFGSKKDPRILKNVSPNDNNSANNNAHSSDLGTVVFDSNEAPPKTSLADWQKEDGIFS
SKTDNIEDPNLSSNITFDGKPTATPSPFRPLEKTSRILNFFDKNTKTTPNTASSEASAGS
KEGASTNWDDHAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSL
TAQKYPIYTGDGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSPAALKQLASLKKSE
EIINNKTSSQTSLSSKDLSNYRKTEGIFEKAKAKAVTSKVRNAEFKVSKNSTSFKNPRRL
EIKDGRSLFLRNRGKIHSGVLSSIESDLKKREQASKSKKSWLNRLNNWLFGWNDL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcagaccttcaaaaacaagagaatagtagcaggttcaccaatgtttctgttatcgcg
cccgaatcacagggacaacatgaacaacaaaaacagcaggagcagctggagcagcaaaag
cagccaacgggactgttaaaaggtttaaacgggtttccgagtgcaccacaaccgctgttc
atggaagatccgccttctactgtctcgggagaactgaatgataatccagcgtggttcaat
aatccaaggaaaagagccattccaaattcaataataaagagatcaaatggccaatcttta
agccccgtacgttctgatagtgcagatgtacctgcgttttccaattccaatggattcaac
aatgtcacttttggctctaaaaaagatccacgcatccttaaaaacgtatctccaaatgat
aataacagtgccaacaacaatgctcatagttcagatttaggtacggtagtttttgattct
aatgaggcaccgcccaagacctccttggcagattggcaaaaagaagatggtatattttca
agtaagactgacaatattgaagatcctaatttgtcttccaacataacctttgatggaaag
cctacagccacaccttcgcctttccgtccactagaaaagacctccagaatacttaatttc
ttcgacaaaaacacgaaaacaacgccgaatactgcgtcaagtgaagctagtgcagggagt
aaggaaggggcctcgacgaattgggatgatcatgccattattatctttggatatccagaa
acgattgcgaattctattatactccattttgctaatttcggtgaaattttagaggatttt
agagtgataaaagattttaaaaagttgaattcgaaaaacatgtcaaaaagtccgtcattg
actgctcaaaaatatcccatatatacaggagatggatgggtcaagttgacttacaaatcc
gaactttccaaatctcgtgctttacaagaaaatgggattataatgaatggaacattaatt
ggctgtgtttcgtatagtccggctgctctcaaacaattagcttccttgaagaaatcggag
gaaattataaacaataaaacaagttcacaaactagtttaagctcaaaagacctcagcaat
tatagaaaaacagaaggaatttttgagaaagctaaggcaaaagcagttacttcaaaagtg
cgcaatgcagaattcaaggtttccaagaattctacttccttcaaaaatccacgcaggctt
gaaataaaggatggtcgttcattatttttgagaaacagagggaagatccacagtggtgtc
ctgagctcgatcgagtctgacttgaagaaaagggaacaagcgagcaagagtaagaaaagt
tggttaaatagattgaataattggttatttggatggaatgatttgtaa

DBGET integrated database retrieval system