KEGG   Saccharomyces cerevisiae (budding yeast): YMR235C
Entry
YMR235C           CDS       T00005                                 

Gene name
RNA1
Definition
(RefSeq) GTPase-activating protein RNA1
  KO
K14319  Ran GTPase-activating protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YMR235C (RNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR235C (RNA1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     YMR235C (RNA1)
SSDB
Motif
Pfam: LRR_6
Other DBs
NCBI-GeneID: 855275
NCBI-ProteinID: NP_013962
SGD: S000004848
UniProt: P11745
Position
XIII:complement(741512..742735)
AA seq 407 aa
MATLHFVPQHEEEQVYSISGKALKLTTSDDIKPYLEELAALKTCTKLDLSGNTIGTEASE
ALAKCIAENTQVRESLVEVNFADLYTSRLVDEVVDSLKFLLPVLLKCPHLEIVNLSDNAF
GLRTIELLEDYIAHAVNIKHLILSNNGMGPFAGERIGKALFHLAQNKKAASKPFLETFIC
GRNRLENGSAVYLALGLKSHSEGLKVVKLYQNGIRPKGVATLIHYGLQYLKNLEILDLQD
NTFTKHASLILAKALPTWKDSLFELNLNDCLLKTAGSDEVFKVFTEVKFPNLHVLKFEYN
EMAQETIEVSFLPAMEKGNLPELEKLEINGNRLDEDSDALDLLQSKFDDLEVDDFEEVDS
EDEEGEDEEDEDEDEKLEEIETERLEKELLEVQVDDLAERLAETEIK
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggctaccttgcacttcgttcctcagcacgaggaagaacaagtttactccatctctggg
aaggcactcaagttaacaaccagtgacgatatcaaaccatacctggaagaattggcagct
ttgaaaacctgtaccaaattagacctttcagggaatacaatcggtactgaagcttcggaa
gcattagctaaatgcatcgctgaaaatacacaggtcagggaatctttggttgaagtaaat
tttgctgacttatacacttcgaggttggttgacgaagtcgttgattcgttgaagttttta
ttgcctgttctgttgaaatgtcctcacttggagattgtgaacctttctgataatgcgttt
gggctaagaacaatcgagttactagaagattacattgcacatgccgtgaatatcaaacat
ttgatcttaagtaacaatggtatgggcccttttgctggtgaaaggattggtaaggcccta
tttcatctcgctcaaaataagaaagctgcttccaaaccatttttggaaacttttatctgt
ggtagaaatagattagagaatggatccgcagtctacttagctctgggtttgaaaagccac
tccgaaggtttgaaagtcgtaaagctgtaccaaaatggtattaggcctaaaggtgtcgcc
acgctaattcattacggtttacagtacttgaaaaacttggaaatcttggatcttcaagac
aatactttcacgaaacatgcttctttgatccttgctaaggccttgcctacatggaaggat
agtttatttgaattgaatttgaacgactgtcttttgaaaactgctggttcagatgaagtc
tttaaagtattcaccgaagttaaattccccaatttgcatgtcttgaaattcgaatataat
gaaatggctcaagaaaccattgaagtatccttcttaccggctatggaaaagggaaattta
cctgaattggaaaagctagaaataaatggtaacagattagatgaagattctgatgcttta
gatttgctccaaagcaaatttgatgatttagaggttgacgattttgaagaggtcgatagt
gaagatgaggaaggcgaggacgaggaagacgaggacgaggatgaaaaactcgaagaaatt
gaaacggaaaggcttgaaaaggaactgctagaagtacaagtagatgatcttgctgaacgt
ttagctgaaactgaaatcaaatag

DBGET integrated database retrieval system