KEGG   Saccharomyces cerevisiae (budding yeast): YMR260C
Entry
YMR260C           CDS       T00005                                 

Gene name
TIF11
Definition
(RefSeq) Tif11p
  KO
K03236  translation initiation factor 1A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YMR260C (TIF11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sce03012]
    YMR260C (TIF11)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    YMR260C (TIF11)
SSDB
Motif
Pfam: eIF-1a
Other DBs
NCBI-GeneID: 855302
NCBI-ProteinID: NP_013987
SGD: S000004873
UniProt: P38912
Structure
PDB: 

Position
XIII:complement(789378..789839)
AA seq 153 aa
MGKKNTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAH
IRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINETDN
FGFESDEDVNFEFGNADEDDEEGEDEELDIDDI
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtaagaaaaacactaaaggtggtaaaaaaggtagaagaggtaagaacgactctgac
ggtccaaagcgtgaacttatttataaggaagaaggccaagaatatgctcaaatcaccaag
atgttgggtaatggaagagtcgaagccagttgctttgatggtaataagagaatggcccat
attagaggtaagttaagaaagaaagtctggatgggacaaggtgatattattcttgtttcc
ttaagagatttccaagatgaccaatgtgatgttgtccacaaatataatttagatgaagcc
agaacactgaaaaaccaaggtgaacttcctgaaaacgccaaaattaatgaaacagacaac
tttggtttcgaatctgatgaagacgttaactttgaatttggtaacgctgatgaagatgat
gaggaaggtgaagatgaagaacttgatattgatgacatttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YNL244C
Entry
YNL244C           CDS       T00005                                 

Gene name
SUI1, MOF2, RFR1
Definition
(RefSeq) translation initiation factor eIF1
  KO
K03113  translation initiation factor 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YNL244C (SUI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sce03012]
    YNL244C (SUI1)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    YNL244C (SUI1)
SSDB
Motif
Pfam: SUI1 Bromo_TP_like
Other DBs
NCBI-GeneID: 855477
NCBI-ProteinID: NP_014155
SGD: S000005188
UniProt: P32911
Structure
PDB: 

Position
XIV:complement(187170..187496)
AA seq 108 aa
MSIENLKSFDPFADTGDDETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKK
DFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF
NT seq 327 nt   +upstreamnt  +downstreamnt
atgtccattgagaatctgaaatcatttgatcctttcgccgacacaggagacgacgaaacc
gccacttcaaactatattcatattcgtatccaacagagaaatggtagaaaaactttaact
acggtgcaaggtgtcccagaggaatatgatttaaagagaattcttaaggtcctaaagaag
gactttgcatgtaatggtaacattgtcaaggatccagaaatgggggagattattcagttg
cagggtgaccaaagagcaaaggtttgcgaatttatgatctcccaactgggattgcaaaag
aagaacattaaaattcatgggttttaa

DBGET integrated database retrieval system