KEGG   Saccharomyces cerevisiae (budding yeast): YNL139C
Entry
YNL139C           CDS       T00005                                 

Gene name
THO2, LDB5, RLR1, ZRG13
Definition
(RefSeq) Tho2p
  KO
K12879  THO complex subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YNL139C (THO2)
  09122 Translation
   03013 RNA transport
    YNL139C (THO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YNL139C (THO2)
   03041 Spliceosome [BR:sce03041]
    YNL139C (THO2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     YNL139C (THO2)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   EJC/TREX
    YNL139C (THO2)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    YNL139C (THO2)
SSDB
Motif
Pfam: THOC2_N Tho2 Thoc2 DUF3938
Other DBs
NCBI-GeneID: 855583
NCBI-ProteinID: NP_014260
SGD: S000005083
UniProt: P53552
Position
XIV:complement(360924..365717)
AA seq 1597 aa
MAEQTLLSKLNALSQKVIPPASPSQASILTEEVIRNWPERSKTLCSDFTALESNDEKEDW
LRTLFIELFDFINKNDENSPLKLSDVASFTNELVNHERQVSQASIVGKMFIAVSSTVPNI
NDLTTISLCKLIPSLHEELFKFSWISSKLLNKEQTTLLRHLLKKSKYELKKYNLLVENSV
GYGQLVALLILAYYDPDNFSKVSAYLKEIYHIMGKYSLDSIRTLDVILNVSSQFITEGYK
FFIALLRKSDSWPSSHVANNSNYSSLNEGGNMIAANIISFNLSQYNEEVDKENYERYMDM
CCILLKNGFVNFYSIWDNVKPEMEFLQEYIQNLETELEEESTKGVENPLAMAAALSTENE
TDEDNALVVNDDVNMKDKISEETNADIESKGKQKTQQDILLFGKIKLLERLLIHGCVIPV
IHVLKQYPKVLYVSESLSRYLGRVFEYLLNPLYTSMTSSGESKDMATALMITRIDNGILA
HKPRLIHKYKTHEPFESLELNSSYVFYYSEWNSNLTPFASVNDLFENSHIYLSIIGPYLG
RIPTLLSKISRIGVADIQKNHGSESLHVTIDKWIDYVRKFIFPATSLLQNNPIATSEVYE
LMKFFPFEKRYFIYNEMMTKLSQDILPLKVSFNKAEREAKSILKALSIDTIAKESRRFAK
LISTNPLASLVPAVKQIENYDKVSELVVYTTKYFNDFAYDVLQFVLLLRLTYNRPAVQFD
GVNQAMWVQRLSIFIAGLAKNCPNMDISNIITYILKTLHNGNIIAVSILKELIITVGGIR
DLNEVNMKQLLMLNSGSPLKQYARHLIYDFRDDNSVISSRLTSFFTDQSAISEIILLLYT
LNLKANTQNSHYKILSTRCDEMNTLLWSFIELIKHCLKGKAFEENVLPFVELNNRFHLST
PWTFHIWRDYLDNQLNSNENFSIDELIEGAEFSDVDLTKISKDLFTTFWRLSLYDIHFDK
SLYDERKNALSGENTGHMSNRKKHLIQNQIKDILVTGISHQRAFKKTSEFISEKSNVWNK
DCGEDQIKIFLQNCVVPRVLFSPSDALFSSFFIFMAFRTENLMSILNTCITSNILKTLLF
CCTSSEAGNLGLFFTDVLKKLEKMRLNGDFNDQASRKLYEWHSVITEQVIDLLSEKNYMS
IRNGIEFMKHVTSVFPVVKAHIQLVYTTLEENLINEEREDIKLPSSALIGHLKARLKDAL
ELDEFCTLTEEEAEQKRIREMELEEIKNYETACQNEQKQVALRKQLELNKSQRLQNDPPK
SVASGSAGLNSKDRYTYSRNEPVIPTKPSSSQWSYSKVTRHVDDINHYLATNHLQKAISL
VENDDETRNLRKLSKQNMPIFDFRNSTLEIFERYFRTLIQNPQNPDFAEKIDSLKRYIKN
ISREPYPDTTSSYSEAAAPEYTKRSSRYSGNAGGKDGYGSSNYRGPSNDRSAPKNIKPIS
SYAHKRSELPTRPSKSKTYNDRSRALRPTGPDRGDGFDQRDNRLREEYKKNSSQRSQLRF
PEKPFQEGKDSSKANPYQASSYKRDSPSENEEKPNKRFKKDETIRNKFQTQDYRNTRDSG
AAHRANENQRYNGNRKSNTQALPQGPKGGNYVSRYQR
NT seq 4794 nt   +upstreamnt  +downstreamnt
atggcagaacagacgctactttccaaattgaacgctctttctcaaaaagtgataccacca
gcttcccctagtcaggcaagcattttaacggaagaggtgatacgaaactggcctgaacga
tcaaaaactctctgctccgatttcactgcactggagtcaaatgatgaaaaggaagactgg
ttgaggactttgtttattgaactgtttgatttcataaataaaaacgatgaaaattctccc
ctcaagctttctgatgttgcatcatttactaatgaattagtgaatcatgaaaggcaagtg
tcccaggcttccatagttggtaaaatgtttatcgccgtctcaagcactgttccaaatata
aatgatctaacaaccatatcattatgtaaactaataccgtcgttgcatgaagaattgttc
aaatttagttggatatcctctaagctgctcaacaaggaacaaaccaccttattaaggcat
ttgttaaaaaagtcaaaatacgaactgaagaaatataaccttttggtagaaaattcagtg
ggttatggtcaattggtagccttattaatattggcgtattatgatcccgacaatttttcc
aaagtgtccgcatatttgaaagaaatctatcatattatggggaaatattccttggattct
attcgtactttagatgttattttgaacgtttctagtcagtttatcactgaagggtacaag
ttctttattgctcttttacgaaagtcggattcttggccatctagccatgtagctaacaat
tccaattattcttctcttaatgaaggcggtaatatgattgcagcaaacattatttcattc
aatttatcgcaatataacgaagaagtcgataaggaaaactatgaacggtatatggatatg
tgttgcattttactgaaaaatgggtttgtcaatttttattctatttgggataacgttaaa
ccagagatggaatttctacaagaatatattcaaaacttagaaactgaactggaagaggag
tccactaaaggcgtagaaaatcccttggctatggcagctgctttgtccactgaaaatgaa
actgacgaagacaacgcccttgttgtaaatgatgatgttaatatgaaggataaaatctct
gaggaaacaaacgctgatatagaatcaaaaggcaagcagaaaactcagcaagatatttta
ttatttggtaaaataaaactcttggaacgcttactcatacatggttgcgttattcccgtg
atacatgtgttaaagcaatatccgaaagtgttatatgttagtgaatccttatctagatat
ttgggaagagtatttgaatatcttttaaatccattgtacacatcaatgacctcatctggt
gaatcaaaagatatggcaactgctttgatgataacccgtatagataatggtattctagcc
cataagccaaggttgatccataaatataaaactcacgagccatttgaatcccttgaattg
aattcaagctacgtcttctattacagcgagtggaattccaatttgactccttttgcttct
gtaaatgatctatttgaaaactcgcatatctatttatctatcataggaccgtatttgggg
agaattcctacgcttttgagtaagatttcacgtattggggtagctgacattcaaaagaac
cacggttctgagtctctgcatgttacgattgataagtggatagactatgtaagaaaattc
atttttccagctacctcgctattgcagaacaatccaattgccacatcggaagtttacgaa
ctaatgaaatttttcccttttgaaaaaagatattttatttacaacgaaatgatgacgaaa
ttatcccaagatattctaccgcttaaggtgagcttcaataaggccgaaagagaagcgaag
agtattttgaaggctttgagtatagatacaatcgcaaaagagtccaggagatttgccaaa
ttaatctctacaaatccattggcctcactggtaccagcagttaagcagattgaaaactat
gacaaagtttctgagcttgttgtttacaccacgaagtactttaacgattttgcgtatgat
gtattgcaatttgtattattgttacgcttaacttataacaggcctgctgttcaatttgat
ggtgttaaccaggccatgtgggtccagagattatcaatatttattgcaggtttggccaaa
aattgtcccaatatggatatctcaaatataatcacctatattttaaagacgttgcataat
gggaatatcatagcagtttctatcctaaaggaattaattattacagtcgggggcattaga
gacttaaacgaagttaatatgaagcaactattaatgttaaactcaggatcaccattaaag
caatatgcaagacatctcatatatgattttagagatgataattcggttatttcgtcgagg
ctaacctcatttttcactgatcagagcgctatttctgagattattctcctgttatacact
ttaaacctgaaagcaaatacgcaaaattctcattacaaaattttatccactagatgcgat
gaaatgaatacattgttatggtcgtttattgagttaattaaacattgtttgaaagggaaa
gcatttgaagagaatgttctcccatttgtagaattgaataataggttccatttatcgaca
ccgtggactttccacatatggagagactacttggataatcaattgaactcaaatgagaat
ttttctattgatgaattaattgaaggtgcagagtttagcgatgttgatttaacgaaaata
tcaaaggatcttttcactactttttggagactttcattatacgatatccatttcgataaa
tcactatatgacgagcgtaagaatgcactatccggagaaaacacgggccacatgtcaaat
agaaaaaaacacctgattcagaatcaaatcaaggatattttggttactggaatttcgcat
caaagagccttcaagaaaacttcagaatttatatctgaaaaatcaaatgtctggaacaaa
gactgcggggaagatcaaattaagatattcttgcagaattgtgttgtgccaagggtttta
ttttctccttcagatgctctcttctcttcgttttttatctttatggcttttaggacagaa
aatttgatgtcgatattgaatacttgtattacatcaaatattttaaaaacgttgctgttc
tgttgtactagctctgaagcaggcaatttaggtctgtttttcactgacgttcttaaaaag
cttgaaaaaatgagattaaatggcgatttcaacgaccaagcttctcgaaagctttatgaa
tggcattcagtaattaccgagcaagtcattgaccttttatccgaaaaaaattacatgtca
attagaaacggtattgaattcatgaagcacgtcactagtgtcttccctgtagtgaaagct
catatccagttggtttacacaactttagaggaaaacttgataaatgaagaaagggaggat
attaaactaccaagcagcgcattgattggccatttgaaagcgcgtttgaaggacgcttta
gaattggacgaattctgcaccttaactgaagaggaagctgaacaaaagagaatacgtgaa
atggaattagaagagatcaaaaattatgaaacagcttgccaaaatgaacaaaagcaagta
gctttaagaaagcagttagagcttaataagtcgcaaagacttcaaaatgatccacccaaa
agtgttgcaagcggcagtgctggattaaatagcaaggatagatatacttattctcgtaat
gagcctgtaatcccaacaaaaccttctagtagtcaatggtcatattccaaagtcaccagg
cacgtcgacgatataaaccattatttggccacgaaccatttacaaaaggcaatttcctta
gtagagaacgacgatgaaactcggaatttaaggaaattatctaagcaaaatatgccaata
ttcgactttagaaattcgactttggaaatattcgaaaggtactttaggacactcattcaa
aatcctcaaaatccagattttgcagaaaaaattgattcgcttaaaaggtatattaaaaat
atctcgcgcgagccatacccagatacgactagctcatattctgaagctgctgctcctgaa
tataccaaaagatcaagtaggtacagcggaaatgctggaggcaaagatggttatggtagt
tccaactatagaggaccaagcaatgatcgttctgcacccaaaaatattaagccaatcagt
agttatgcacataaaaggtcagaactaccaactagacctagtaaaagtaaaacatataat
gatagaagtagggcacttagacccacaggtccggacaggggcgatggttttgatcaaagg
gataaccgcttacgtgaagagtataagaaaaacagttcacaacgttcacaattacggttt
cctgaaaagccatttcaagagggcaaagacagcagcaaagccaacccttaccaagcttca
tcttacaagcgcgactcgccttcagaaaatgaagaaaagccgaataaaagattcaagaag
gatgaaacaattagaaacaaatttcaaacgcaagattatagaaatacacgagatagcggt
gctgcccatagagccaatgaaaatcaaaggtacaacggaaatagaaagagcaatactcag
gcgcttccgcaaggtcccaagggtgggaattacgtcagtaggtaccagaggtaa

DBGET integrated database retrieval system