KEGG   Saccharomyces cerevisiae (budding yeast): YNL253W
Entry
YNL253W           CDS       T00005                                 

Gene name
TEX1
Definition
(RefSeq) Tex1p
  KO
K12880  THO complex subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YNL253W (TEX1)
  09122 Translation
   03013 RNA transport
    YNL253W (TEX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YNL253W (TEX1)
   03041 Spliceosome [BR:sce03041]
    YNL253W (TEX1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     YNL253W (TEX1)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   EJC/TREX
    YNL253W (TEX1)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    YNL253W (TEX1)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 DUF4800 DUF4130
Other DBs
NCBI-GeneID: 855468
NCBI-ProteinID: NP_014146
SGD: S000005197
UniProt: P53851
Position
XIV:170018..171286
AA seq 422 aa
MSTIGAVDILNQKTITSEVAASVTSKYLQSTFSKGNTSHIEDKRFIHVSSRSHSRFTSTP
ITPNEILSLKFHVSGSSMAYSRMDGSLTVWFIKDASFDKSVEVYIPDCCGSDKLATDLSW
NPTSLNQIAVVSNSSEISLLLINEKSLTASKLRTLSLGSKTKVNTCLYDPLGNWLLAATK
SEKIYLFDVKKDHSSVCSLNISDISQEDNDVVYSLAWSNGGSHIFIGFKSGYLAILKAKH
GILEVCTKIKAHTGPITEIKMDPWGRNFITGSIDGNCYVWNMKSLCCELIINDLNSAVTT
LDVCHLGKILGICTEDEMVYFYDLNSGNLLHSKSLANYKTDPVLKFYPDKSWYIMSGKND
TLSNHFVKNEKNLITYWKDMFDNTMIEKRRKNNGGGNNHNKRTSKNTDRIGKDRPSRFNS
KK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgtcgacaattggagctgttgatattcttaatcaaaagaccataacttctgaagtggct
gcctcagtgacttcaaaatatctacaaagtacgttttctaaaggtaatacaagtcatatc
gaagataaaaggttcattcatgtcagttcgcgttctcattcaagattcacctcgactccc
ataactccaaatgaaattctttccctaaaatttcacgtatcaggttcatcgatggcgtat
agtagaatggatgggtcattgaccgtttggtttattaaagatgcaagttttgacaaatct
gtagaagtttatattccagactgttgtggttccgataaattggctactgatttgtcctgg
aaccctacttctttaaatcaaatagctgtcgtgagcaattcatcagagatatccttactc
ttaatcaacgaaaaatcgctaacggcatccaaattaaggaccttgtcattgggaagcaag
actaaggtcaacacatgtctttatgatccattaggaaactggttattagctgccaccaaa
tctgagaaaatctacttgtttgatgtgaaaaaggatcacagctctgtctgttctttgaac
atcagcgatataagccaagaggataatgacgttgtgtattccttagcatggagcaatggt
ggaagtcatatatttattggctttaagagtggttatttggccattttaaaagcaaaacat
ggcatattggaggtttgtaccaaaattaaagcacatactggtcctataaccgagatcaaa
atggacccatggggaagaaacttcattactgggagtatcgatgggaattgctacgtatgg
aatatgaagtcactatgttgtgaattaataattaacgatttgaactctgcggtaacaaca
ctagacgtctgtcatttgggtaaaatactaggaatttgtacagaagatgaaatggtatat
ttctatgatcttaatagtggtaatttactccactctaaatctttagccaattacaaaacc
gatcccgttttgaagttttatcctgataaatcatggtatatcatgtcaggcaagaatgac
acactatcaaatcattttgttaaaaacgaaaaaaatctaataacttattggaaagacatg
ttcgataacacgatgattgaaaaacgtaggaaaaacaacggtggaggcaacaaccacaat
aaaaggacgagtaagaatactgataggattggcaaggataggccgagtagattcaactca
aaaaaataa

DBGET integrated database retrieval system