KEGG   Saccharomyces cerevisiae (budding yeast): YOR046C
Entry
YOR046C           CDS       T00005                                 

Gene name
DBP5, RAT8
Definition
(RefSeq) ATP-dependent RNA helicase DBP5
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YOR046C (DBP5)
   03015 mRNA surveillance pathway
    YOR046C (DBP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YOR046C (DBP5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YOR046C (DBP5)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     YOR046C (DBP5)
SSDB
Motif
Pfam: DEAD Helicase_C AAA_30 AAA_22
Other DBs
NCBI-GeneID: 854211
NCBI-ProteinID: NP_014689
SGD: S000005572
UniProt: P20449
Structure
PDB: 

Position
XV:complement(414459..415907)
AA seq 482 aa
MSDTKRDPADLLASLKIDNEKEDTSEVSTKETVKSQPEKTADSIKPAEKLVPKVEEKKTK
QEDSNLISSEYEVKVKLADIQADPNSPLYSAKSFDELGLAPELLKGIYAMKFQKPSKIQE
RALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLE
VVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDE
ADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVN
VDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSIL
HGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATY
IHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVL
KD
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagtgatacaaagagagatccggccgatttactagcttctttaaagattgataatgag
aaagaggatacaagtgaagtttcaacaaaagagactgttaagtcccaaccagaaaagact
gctgattcgatcaagcctgcagaaaaattagttccaaaagttgaggaaaaaaaaacaaaa
caggaggatagtaatttaatcagctcagaatatgaagttaaggtcaaacttgctgatatc
caggctgacccaaattctccattgtacagtgctaaatcttttgatgaattaggattagca
ccagaactactaaaggggatatatgctatgaaatttcaaaaaccatccaaaattcaagaa
agggcgctgccattattattacataatccgcctaggaacatgattgctcagtctcaatca
ggtacaggtaaaactgccgccttttctttaacgatgctaacaagagtaaacccagaagac
gcatctccacaggcaatttgcttagccccctccagagaactggccagacaaacactagaa
gtcgttcaggaaatgggtaagttcacaaaaataaccagtcagttaattgttcccgattct
tttgagaaaaacaagcaaattaatgctcaagtgattgttggtacgccgggcactgttctt
gacctaatgcgtagaaaattgatgcagctacagaaaattaaaatttttgttttggatgaa
gccgataacatgttggatcagcagggtctaggtgaccagtgtattcgtgttaagagattt
ttacccaaggatactcaacttgttttgtttagtgctacttttgccgatgcagttaggcag
tacgcaaagaagatcgttccaaatgctaatactttagaattacaaacaaatgaagttaat
gttgatgccatcaaacaactatacatggactgcaaaaacgaagcagataagtttgatgtt
ttaactgagctatatggtttaatgacaattggatcttccattatttttgttgcaaccaaa
aaaaccgcaaacgttttatatgggaaattgaaaagtgaaggtcatgaagtttctatcttg
catggtgatttacagacacaagaaagagacagattaatagacgacttcagagagggtaga
tccaaagttttgattactactaatgtcctggcccgtggtattgatattcctactgtctca
atggttgtcaactatgatcttccaacgcttgctaacggacaagcagatccagctacttac
attcacagaatcggtagaaccggtagattcggcagaaaaggtgttgccatttcctttgta
catgacaaaaattctttcaatattttatctgcaattcagaaatacttcggtgatatagaa
atgactcgtgttccaacggatgattgggatgaagtcgaaaaaatagttaagaaagtgtta
aaggattag

DBGET integrated database retrieval system