KEGG   Saccharomyces cerevisiae (budding yeast): YPL157W
Entry
YPL157W           CDS       T00005                                 

Gene name
TGS1
Definition
(RefSeq) RNA methyltransferase
  KO
K14292  trimethylguanosine synthase [EC:2.1.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YPL157W (TGS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     YPL157W (TGS1)
SSDB
Motif
Pfam: Methyltransf_15 Methyltransf_31 UPF0020 Methyltransf_25 Cons_hypoth95 MethyltransfD12 Methyltransf_23 Methyltransf_11
Other DBs
NCBI-GeneID: 855946
NCBI-ProteinID: NP_015168
SGD: S000006078
UniProt: Q12052
Position
XVI:254814..255761
AA seq 315 aa
MGRTFIHASKIKHAARKRKHHSNFRTLIKLLNNDAYKIESSKPLKNGKLFKYWKNRRRLF
SKIDSASIYMTDELWFSVTPERIACFLANFVKACMPNAERILDVFCGGGGNTIQFAMQFP
YVYGVDYSIEHIYCTAKNAQSYGVDDRIWLKRGSWKKLVSKQKLSKIKYDCVFGSPPWGG
PEYLRNDVYDLEQHLKPMGITKMLKSFLKLSPNVIMFLPRNSDLNQLSRATRKVLGPFAK
CKVLYVKENGYMKGIFCMWGECFFNYEPASTENSRRESSEKEELSSENEELSKRKKHEST
TTTKDNTVDIYDVNG
NT seq 948 nt   +upstreamnt  +downstreamnt
atgggaaggacatttattcatgcttcgaaaataaaacatgcggcacgcaaaagaaaacat
cattccaactttagaactctgatcaaattattgaacaatgatgcctataagatagaatca
tcaaaaccgttgaaaaatggtaaacttttcaaatactggaaaaataggcgtagattgttt
tcaaagatagattcggcgtcgatatatatgactgatgagctgtggttcagtgtgacgccc
gaaagaattgcctgcttcctggcaaattttgttaaggcatgcatgccaaatgccgaaaga
atactggatgttttctgtggtgggggcgggaacaccatacaatttgccatgcaatttcct
tacgtctatggagtggactacagtattgaacacatatattgtactgcgaaaaacgcccaa
agctacggtgtggacgacagaatatggctgaagcggggatcctggaaaaagctagtctct
aagcagaaactttccaaaataaagtacgactgtgtatttggatcacccccgtggggtggt
ccagaatacttaagaaacgatgtgtatgacttagagcaacatctaaagcctatggggatt
accaagatgttgaaaagttttcttaaactaagccctaatgtgattatgtttttgccaagg
aactctgatttgaaccagctttctcgagctacgaggaaagtactaggtccatttgccaaa
tgtaaagtattatatgtaaaggagaatggatatatgaaaggaatattttgcatgtggggg
gaatgcttttttaactacgaaccagcaagtacggagaatagtcgaagggagtcgtccgaa
aaggaagagctgagttctgaaaacgaagagctctcgaaaagaaaaaagcatgaatccaca
acaacgaccaaagataatactgtagacatttacgacgtaaatggttaa

DBGET integrated database retrieval system