KEGG   Saccharomyces cerevisiae (budding yeast): YPL169C
Entry
YPL169C           CDS       T00005                                 

Gene name
MEX67
Definition
(RefSeq) Mex67p
  KO
K14284  nuclear RNA export factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YPL169C (MEX67)
   03015 mRNA surveillance pathway
    YPL169C (MEX67)
   03008 Ribosome biogenesis in eukaryotes
    YPL169C (MEX67)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YPL169C (MEX67)
   03009 Ribosome biogenesis [BR:sce03009]
    YPL169C (MEX67)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YPL169C (MEX67)
   mRNA cycle factors
    Stress granule specific factors
     YPL169C (MEX67)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YPL169C (MEX67)
SSDB
Motif
Pfam: RRM_9 TAP_C LRR_9 LRR_4
Other DBs
NCBI-GeneID: 855934
NCBI-ProteinID: NP_015156
SGD: S000006090
UniProt: Q99257
Structure
PDB: 
6EXZ 1OF5 4WWU 2KHH 2JP7

Position
XVI:complement(229039..230838)
AA seq 599 aa
MSGFHNVGNINMMAQQQMQQNRIKISVRNWQNATMNDLINFISRNARVAVYDAHVEGPLV
IGYVNSKAEAESLMKWNGVRFAGSNLKFELLDNNGASAGTSDTISFLRGVLLKRYDPQTK
LLNLGALHSDPELIQKGVFSSISTQSKMFPAMMKLASTEKSLIVESVNLADNQLKDISAI
STLAQTFPNLKNLCLANNQIFRFRSLEVWKNKFKDLRELLMTNNPITTDKLYRTEMLRLF
PKLVVLDNVIVRDEQKLQTVYSLPMKIQQFFFENDALGQSSTDFATNFLNLWDNNREQLL
NLYSPQSQFSVSVDSTIPPSTVTDSDQTPAFGYYMSSSRNISKVSSEKSIQQRLSIGQES
INSIFKTLPKTKHHLQEQPNEYSMETISYPQINGFVITLHGFFEETGKPELESNKKTGKN
NYQKNRRYNHGYNSTSNNKLSKKSFDRTWVIVPMNNSVIIASDLLTVRAYSTGAWKTASI
AIAQPPQQQASVLPQVASMNPNITTPPQPQPSVVPGGMSIPGAPQGAMVMAPTLQLPPDV
QSRLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgagcggatttcacaatgttggaaatatcaatatgatggctcaacagcagatgcaacaa
aatagaataaagattagcgtgaggaactggcagaatgcaaccatgaacgatttgattaat
tttataagccgcaacgctcgagtagctgtttatgacgctcatgtggaaggacctttagtt
attggatatgtcaactcaaaggcagaagcagaatcgttaatgaaatggaacggtgtccgg
tttgcaggcagtaatttaaagttcgaacttttagataacaatggggcctctgcgggaact
tcagacaccatttcgttcttgaggggggtgctccttaagaggtatgacccacaaacaaaa
ttactaaatttgggcgctttacattcagatcccgagctaattcaaaagggcgtctttagt
tccatctccacccagtctaagatgtttccagcaatgatgaaactggcttctacagaaaaa
agtttgatagtggaaagtgtcaatcttgctgacaaccaacttaaggacatctcagcaatt
tccacattggctcaaacatttcctaatttgaaaaacctctgtctggccaacaatcagatt
tttagatttagatcgctagaagtttggaagaacaaattcaaagatctaagagagcttttg
atgacaaataacccgataaccaccgataagttgtatcgcactgaaatgttaagattattt
ccgaaattggttgtactagataacgtgattgtgagagacgaacaaaaattgcaaaccgtt
tactcattaccgatgaagattcaacagttttttttcgaaaacgatgcattagggcaatca
tctacagactttgcaactaactttttgaatctatgggataataatagagaacaactgtta
aatttgtattcgccccaatcccagttttctgtttccgtggattctactattcctccatct
acggtaacagattcggaccaaactccagcatttggttattacatgtcgtcctcacgtaat
atatccaaagtgtccagtgaaaaatctatccagcagagattgtcaatcgggcaagagtcc
attaatagtatattcaagactttgccgaaaacaaagcaccatttacaagaacaacccaat
gaatactcaatggaaacaattagttatcctcaaataaatgggttcgttattacgttgcac
ggattttttgaagagactggcaagcctgaactggaatccaataaaaaaacggggaaaaat
aactatcaaaagaatagaagatacaatcatggttacaactccacatcaaataataagtta
tccaaaaaatcctttgatagaacctgggtaattgttccaatgaataatagtgtcataatc
gcatctgatctgttaactgtaagagcgtattccacaggcgcttggaaaactgcatctatt
gcaatagcacagcctccacagcaacaggcctcggtcctaccacaggtcgcaagcatgaac
ccaaatataacgacaccaccgcagccacaaccttcagtggtaccaggagggatgagcatt
cccggcgcaccccaaggagccatggtcatggctcccactttgcaactacctccagatgtc
cagtcgcggctaaatcccgtacaactcgagctgctgaataaactacatttggaaacgaaa
ttgaatgcagaatacacgtttatgttggccgagcaaagtaactggaactatgaagttgcc
ataaagggttttcagagtagcatgaatggcatccctagagaagcatttgtgcagttctaa

DBGET integrated database retrieval system