KEGG   Saccharomyces cerevisiae (budding yeast): YPR163C
Entry
YPR163C           CDS       T00005                                 

Gene name
TIF3, RBL3, STM1
Definition
(RefSeq) Tif3p
  KO
K03258  translation initiation factor 4B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YPR163C (TIF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YPR163C (TIF3)
   03012 Translation factors [BR:sce03012]
    YPR163C (TIF3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YPR163C (TIF3)
   mRNA cycle factors
    Stress granule specific factors
     YPR163C (TIF3)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    YPR163C (TIF3)
SSDB
Other DBs
NCBI-GeneID: 856292
NCBI-ProteinID: NP_015489
SGD: S000006367
UniProt: P34167
Position
XVI:complement(868645..869955)
AA seq 436 aa
MAPPKKTVKKMDLTSFLNDDTFGSSWAEEDVDLNKITIPIETANANTIPLSELAHAKNNS
NNTRSGGFGGSFGGRSRLDPALGGGSSDRREEYPVPDAPPYRAVINNIPWDITPEGVQAW
VEDGLVKPEAVEEVVLPKNLRDPTRLKGNAFVTLKERADLVAVLKFNGTKLNERTVYVSV
AAPRRGGGADVDWSSARGSNFQGDGREDAPDLDWGAARGSNFRGPRREREEVDIDWTAAR
GSNFQGSSRPPRREREEVDIDWSAARGSNFQGSSRPPRREREEPDIDWSAARGSNFQSSS
RPPRREREEPDIDWSAARGSNFQSSSRPPRREREKEEPALDWGAARGAQFGKPQQTKNTY
KDRSLTNKKTTDEQPKIQKSVYDVLRTEDDDEDEEAEKQNGDAKENKVDAAVEKLQDKTA
QLTVEDGDNWEVVGKK
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggctccaccaaagaaaaccgtaaagaagatggaccttacgtcatttttaaatgatgac
acctttggttcatcttgggctgaagaagatgtcgatttgaataagatcacaattcctatt
gaaaccgctaatgcaaacactattccattgtccgaattggctcatgctaaaaacaacagc
aataacacgcgttcaggcggctttggtggcagttttggaggtagatctagattagaccct
gctttggggggcggttcttccgatagaagagaggaataccctgttccagatgctccacca
tatagggctgtcataaacaacattccatgggatattaccccagagggtgttcaagcctgg
gttgaagatggtttagttaagcctgaagcggttgaagaagttgttttgccaaagaatcta
agagacccaacaagattaaagggtaatgctttcgttactttgaaagaaagagcagatttg
gtcgccgttctgaagttcaacggtactaaattgaatgagagaactgtttacgtttctgtt
gcggctccaagaagagggggaggtgcagatgttgattggagtagtgctagaggctccaat
ttccaaggtgatggaagagaagatgcaccagatcttgattggggtgccgctagaggttct
aacttcagaggtccaagaagagaaagagaagaagttgatattgactggactgctgcaaga
ggttccaatttccaaggctcttccagaccaccaagaagagaaagagaagaagttgatatc
gactggagcgctgcaagaggctccaatttccaaggctcttccagaccaccaagaagagaa
agagaagagccagatattgactggagtgcagctagaggctctaactttcaaagctcctcg
aggccaccaagaagagaaagagaagagccagatattgactggagtgcagccagaggttcc
aacttccaaagctcctcaagaccaccaagaagagaaagagaaaaggaagaaccagctttg
gattggggtgctgccagaggtgctcagtttggtaagcctcaacaaaccaaaaatacctac
aaggataggtctctaactaacaaaaagactactgatgagcaaccaaaaatccagaagtct
gtttatgatgttttacgtactgaagatgatgatgaagatgaagaggctgaaaagcaaaat
ggagacgcaaaagaaaacaaagttgatgcggcagttgaaaagctacaggataaaactgct
caattgactgttgaagatggtgacaattgggaagttgttggtaagaaatag

DBGET integrated database retrieval system