KEGG   Streptomyces chromofuscus: IPT68_01680
Entry
IPT68_01680       CDS       T07378                                 

Name
(GenBank) 2,4,6-trichlorophenol monooxygenase
  KO
K24293  3,5,6-trichloropyridin-2-ol/2,4,6-trichlorophenol monooxygenase [EC:1.14.14.172 1.14.14.173]
Organism
schf  Streptomyces chromofuscus
Pathway
schf00361  Chlorocyclohexane and chlorobenzene degradation
schf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:schf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    IPT68_01680
Enzymes [BR:schf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.172  3,5,6-trichloropyridin-2-ol monooxygenase
     IPT68_01680
    1.14.14.173  2,4,6-trichlorophenol monooxygenase
     IPT68_01680
SSDB
Motif
Pfam: HpaB_N HpaB Acyl-CoA_dh_M
Other DBs
NCBI-ProteinID: QOV44758
UniProt: A0A7M2TAK3
Position
complement(409176..410711)
AA seq 511 aa
MRTGDQYLESLRDGRVLWVGGDRVDDVTTHPKTRAQAKRIAKFYDLHHDPKMQDVMTFVD
DDGERRSMMWFKHTDAEGLRRKRVYLETVVRELDGGSTGRTPCANNYGLVTYEEDPAPWS
EQSVGTDGRDLTVGIREFLELVKEGDLNCAFAFIDPQLDRSKESSAKSSPTLRIVERRED
GIVVAGVKAVSTGTPFADYIHLGVFYRPGIQSEQVIYGAVPANAPGVTMVSREATVRDDP
DNHPLASAGDELECTVIFDNVFIPWERVFHIGSPEHASLYPQRIFDWVHYEALIRTMVRA
ELMVGLALLMTEHIGTFQLPPVQARVARLVEFYQTLRAHVIASETEGFLSPAGLFKPNVL
LFDFGRSYYLERYAEMRNEVVDLAGRASLLFPTEEQWNNPELHDWLEPLQSGAVGEPYDR
MRISRVIRDLFLTDFGDRVSTFEQFNGTPMLTTRMLTMKRSELSPSGPLTELARRVCGIS
APAAPEVTAYTEQAEYARRLDGARAQGSLVR
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgcggaccggcgatcagtatctggagtccctcagggacgggcgcgtcctctgggtcgga
ggtgaccgggtcgacgacgtcaccacgcacccgaagaccagggcgcaggccaagcgcata
gcgaagttctacgacctgcaccacgacccgaagatgcaggacgtcatgaccttcgtcgac
gacgacggagaacgtcgctcgatgatgtggttcaagcacacggacgccgaagggctgcgg
cgcaagcgcgtctacctcgagaccgtggtccgggaactcgacggcgggtcgacgggacga
accccgtgcgcgaacaactacggcctggtcacctacgaggaggacccggcgccgtggagc
gagcagtccgtgggcaccgacgggcgtgacctgaccgtcggcatccgggagttcctggaa
ctggtgaaggagggtgacctcaactgcgccttcgccttcatcgacccccagctcgaccgg
tcgaaggagtcctccgccaagagctcgcccacgctgcgcatcgtggagcggcgcgaggac
ggcatcgtcgtggccggcgtcaaggcggtgagcaccggcaccccgttcgccgactacatc
cacctcggcgtcttctaccgcccgggcatccagagcgagcaggtcatctacggcgccgtg
ccggccaacgcgccgggcgtcacgatggtctcgcgcgaggcgaccgtgcgcgacgacccc
gacaaccacccgctggcctcggccggtgacgagctggaatgcaccgtcatcttcgacaac
gtgttcattccgtgggaacgggttttccacatcggcagccccgagcacgcctcgctgtac
ccgcagcgcatcttcgactgggtgcactacgaggcgctgatccggacgatggtgcgggcc
gagctcatggtcgggctcgcgctgctgatgaccgagcacatcggcaccttccagcttccg
ccggtccaggctcgcgtggcacgtctcgtcgagttctaccagacgctgcgcgcccacgtg
atcgcctccgagacggaagggttcctgtcccctgccgggctcttcaagccgaacgtcctg
ctcttcgacttcggccggtcctactacctggagcggtacgcggagatgcgcaacgaggtg
gtcgacctcgccggccgcgcgtcgctgctgttccccaccgaggagcagtggaacaacccc
gagctgcacgactggctcgaaccgctgcagtccggtgcggtcggggaaccctacgaccgc
atgcgcatctcgcgggtgatccgcgacctgttcctcacggacttcggtgaccgcgtgagc
accttcgaacagttcaacggcaccccgatgctcaccacgcggatgctcaccatgaagcgc
tcggagctgtcgccgtccgggccgctcaccgaactcgcccggagggtctgcggcatctcg
gcgcccgccgctcccgaggtgacggcctacacggagcaggccgagtacgcccggcgcctg
gacggcgcgcgggcccaaggctcactggtccgctga

DBGET integrated database retrieval system