KEGG   Streptomyces clavuligerus: BB341_07750
Entry
BB341_07750       CDS       T04717                                 

Name
(GenBank) cephalosporin hydroxylase
  KO
K18062  cephamycin C biosynthesis protein
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00311  Penicillin and cephalosporin biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BB341_07750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sclf01008]
    BB341_07750
Polyketide biosynthesis proteins [BR:sclf01008]
 Nonribosomal peptide tailoring proteins
  Others
   BB341_07750
SSDB
Motif
Pfam: CmcI Methyltransf_24 DUF1641
Other DBs
NCBI-ProteinID: ANW18124
UniProt: B5GLB3
Structure
Position
2006575..2007285
AA seq 236 aa
MNDYSRQNFLDLNLFRGLGEDPAYHPPVLTDRPRDWPLDRWAEAPRDLGYSDFSPYQWRG
LRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDLS
RCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIMKWAVDHLLEEG
DYFIIEDMIPYWYRYAPQLLSEYLGAFRDVLSMDMLYANASSQLDRGVLRRVAAKQ
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaacgactactctcgtcagaacttcctggatctgaacctgttccggggtctgggtgag
gacccggcctatcaccctcccgtcctgacggaccggccgcgtgactggcccctcgaccgc
tgggccgaggccccgcgcgacctcggctactcggacttctccccgtaccagtggcgcggg
ctgcggatgctcaaggaccccgacacccaggccgtctaccacgacatgctctgggagctg
cgcccgcgcaccatcgtggagctgggtgtgtacaacggcggctcgctggcctggttccgc
gatctcaccaagatcatggggatcgactgccaggtcatcggcatcgaccgggacctgtcc
cgatgtcagatccccgcgtccgacatggagaacatcaccctgcaccagggcgactgctcc
gacctcacgaccttcgagcacctgcgggagatggcccacccgctgatcttcatcgacgac
gcccacgccaacaccttcaacatcatgaagtgggcggtcgaccatctcctcgaagagggc
gactacttcatcatcgaggacatgatcccgtactggtaccggtacgccccgcagcttctc
tccgagtacctcggcgccttccgcgacgtcctgtccatggacatgctgtacgcgaacgcc
agctcgcagctcgaccgcggcgtcctccgccgagtggcggccaagcagtag

DBGET integrated database retrieval system