KEGG   Streptomyces clavuligerus: BB341_28045
Entry
BB341_28045       CDS       T04717                                 
Name
(GenBank) terpene synthase
  KO
K23530  hydropyrene/hydropyrenol/isoelisabethatriene synthase [EC:4.2.3.201 4.2.3.202 4.2.3.203]
Organism
sclf  Streptomyces clavuligerus
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BB341_28045
Enzymes [BR:sclf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.201  hydropyrene synthase
     BB341_28045
    4.2.3.202  hydropyrenol synthase
     BB341_28045
    4.2.3.203  isoelisabethatriene synthase
     BB341_28045
SSDB
Motif
Pfam: Terpene_syn_C_2 TRI5 Phosphorylase
Other DBs
NCBI-ProteinID: ANW22192
UniProt: D5SK09
Position
pSCL4:69536..70501
AA seq 321 aa
MTISVPQLDCPLSRPVHPEGERADAYAVEWLRGVGLMADEADAAPVLAVGLGRLAACYVD
ENASWDTLAFMTILMAWYAEYDDRAIDSTGAIDGLTDAEVAELHRALGEILRDRPAPDPS
DPVQRGLADVWRTLNGLASDWDRAAFVDTTLRYFEANRYERVNIRRGIPPTPSAHIGMRR
HGGHVYGMYILGAAVNGYRPERRVLDHAAVRELETLAANYTSWANDLHSFAREHRMGQVN
NLVWSVHHHEGLTFQQAADRVADLCDKELAAYLELRQTLPELGIPLTGATGRHVRFLEDM
MWSMVDWSARSARYDVVPEAA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaccatctccgttccccagctcgactgcccgctgagccgtccggtccacccggaagga
gaacgggccgacgcgtacgccgtggagtggttgcgcggcgtgggcctcatggcggacgag
gccgacgccgccccggtcctggccgtcgggctcggcaggctcgccgcgtgctatgtcgac
gagaacgcctcctgggacacgttggccttcatgaccatcctgatggcctggtacgccgag
tacgacgaccgcgcgatcgactccaccggcgcgatcgacggtctgacggacgcggaggtg
gcggaactccaccgcgccctcggggagatcctgcgcgaccggcccgcacccgacccctcc
gaccccgtacaacgcggactggccgacgtctggcggacgctgaacggcctcgcgtccgac
tgggaccgcgctgccttcgtcgacaccaccctccgctacttcgaagccaaccggtacgag
cgggtcaacatccgccggggaatccctccgactccttccgcccatatcggcatgcgccgc
cacggcggccatgtgtacggcatgtacatcctgggtgcggcggtcaacggctaccggccc
gagcgccgggtgctcgaccacgccgccgtccgcgaactggagaccctcgccgcgaactac
acctcgtgggcgaacgatctgcactccttcgcccgcgaacaccgcatgggccaggtcaac
aatctggtctggtcggtccaccaccacgaggggctgaccttccagcaggcggcggaccgg
gtcgccgatctgtgcgacaaggaactggccgcctatctggagctgcggcagacgctgccc
gagttgggcatccccctcaccggggccaccggacggcatgtcaggttcctggaggacatg
atgtggtccatggtcgactggtctgcgcggagcgcgcgctacgacgtcgtgcccgaggcc
gcctga

DBGET integrated database retrieval system