KEGG   Streptomyces clavuligerus: BB341_29635
Entry
BB341_29635       CDS       T04717                                 
Name
(GenBank) FAD-binding monooxygenase
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00404  Staurosporine biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Module
sclf_M00805  Staurosporine biosynthesis, tryptophan => staurosporine
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    BB341_29635
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-
     BB341_29635
SSDB
Motif
Pfam: FAD_binding_3 DAO NAD_binding_8 FAD_binding_2 Pyr_redox_2 HI0933_like Lycopene_cycl B12-binding_2 Pyr_redox_3
Other DBs
NCBI-ProteinID: ANW22477
UniProt: D5SL01
Position
pSCL4:complement(458955..460604)
AA seq 549 aa
MGSAEWTDVLIVGGGPVGMALALDLAYRGVDCVVADAGDGTVRHPKVSTIGPRSMELFRR
WGVADAVRDAGWPPDHPLDIAWVTQVGGHELHRYHRGTAGNRPVFAHTPEPDQVCPAHWL
NPVLARAVGVHPDGPLRLRTTVDRVLRRDDYVEATLIDQATGTSGSIRARFLVACDGAAS
PIRRSCGIDAPPRHRTRVFRNILFRAPGLREQLGDRAALVHFLVRSQTLRFPLRSLDGGD
LYTMVVGADEDTPAGRGGGTAAGRGDALALIGDALAVDTPVELLGDGLWRLTHRVADRYR
AGRVFLAGDAAHTLSPSGGFGLNTGIGDAADLGWKLAAALDGWAGRQLLDTYQTERRPIA
VESLEEAHVHLQRTLRRPVPPGIHREGPEGGRARAEMAEQLRNSGVQREFDAPEIHFGLR
YRSPAIIEDPTVPVRRGKPDADWRPGSEPGSRAAHAWWDGATSTLDLYGRGFVLLCFAGH
EGVAGVERAFAERRVPLTVCRGGAGEVAACYERAFVLVRPDGHVAWRGDALPGDPGRLAD
TVRGDGADG
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgggctccgccgagtggaccgatgtcctgatcgtgggcggtggcccggtcgggatggcg
ctggcgctggatctggcgtaccggggggtggactgcgtggtcgcggacgccggtgacgga
acggtccggcaccccaaggtgagcacgatcggcccgcgttcgatggagctgttccgccgc
tggggtgtcgcggacgccgtacgggacgccggatggcccccggaccaccccctggacatc
gcgtgggtgacccaggtgggcggccatgagctgcaccgctaccaccgggggacggccggg
aaccgcccggtcttcgcccatacgccggagcccgaccaggtctgcccggcgcactggctg
aatccggtgctggcccgggcggtgggggtccatccggacgggccgctgcgactgcgtacg
accgtcgaccgtgtgctgcggagagacgattacgtggaggcgacccttatagatcaggcc
accgggacgagcggcagcatacgcgcgcgcttcctggtcgcctgcgacggcgccgcctcc
ccgatccgccggagctgcggcatcgacgcgccgccccggcaccgcacccgggtcttccgt
aacatcctcttccgcgcccccggcctcagggaacagctcggcgaccgcgccgccctcgtc
cacttcctcgtacggtcgcagaccctgcgcttcccgttgcgttcgctggacggcggcgat
ctgtacaccatggtcgtgggcgcggacgaggacactccggccgggcggggcggcggcacc
gccgcggggcggggtgacgcgctggcgctgatcggcgacgcgctcgccgtcgacacaccg
gtggagttgctgggcgacggcctgtggcggctcacccaccgggtcgccgaccggtaccgg
gccggacgggtcttcctcgccggggacgccgcgcacacgctgtcgccgtccggcggtttc
gggctcaacaccggtatcggcgacgccgccgacctgggctggaagctcgccgccgcactg
gacggctgggccgggaggcagttgctcgacacctatcagaccgaacgcagaccgatcgcc
gtggagagtctggaggaggcgcatgtccacttgcagcgcaccctgcggcggccggtgccg
cccggcatccaccgcgaggggcccgagggcgggcgggcgcgcgcggagatggcggaacag
ctccggaacagcggcgtccagcgggagttcgacgccccggagatccacttcgggctgcgc
taccgctcccccgcgatcatcgaggaccccaccgtccccgtgcgccgcggaaagccggac
gccgactggcgccccggcagcgagcccggcagccgcgccgcgcacgcgtggtgggacggg
gccacgtccacgctcgatctgtacgggcgcgggttcgtgctgctgtgcttcgccgggcac
gagggggtggcgggggtcgagcgcgccttcgccgaacggcgcgttccgctgacggtgtgc
cgtggcggcgccggggaggtggccgcgtgctacgaacgggccttcgtgctggtgcggccg
gacggccatgtggcgtggcgcggcgacgcgcttccgggggacccggggaggctcgccgac
acggtacggggcgacggggccgacggctga

DBGET integrated database retrieval system