KEGG   Stanieria cyanosphaera: Sta7437_4395
Entry
Sta7437_4395      CDS       T02406                                 
Name
(GenBank) homoaconitate hydratase family protein
  KO
K17749  3-benzylmalate isomerase [EC:4.2.1.-]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
scs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sta7437_4395
Enzymes [BR:scs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     Sta7437_4395
SSDB
Motif
Pfam: Aconitase Aconitase_C AcnX
Other DBs
NCBI-ProteinID: AFZ37864
UniProt: K9Y0N2
Position
4930039..4931751
AA seq 570 aa
MNKFENILYLGDDINTDDIIPAKRGTNGDLEHLARYALEYLIGENKLKEYNIIEAGDNFG
CGSSREYAPLAIKAAGIKKVRARSFAEIFYRNSINIGLNLEIIGENQNNSVIEAISQAGG
LIAFNQQRLQGKVTIPPSHTKPRPMTIAEKLLAKASGNQYVQPGEVIFAKVDLAMSHDAI
AFPVGQLFYQHFGQDAKVWDANRVVLVADHFIQINEIRKDLGAVEMYQGMVDFAKQQGCH
LLDLVASGEAQGICHVLLPEQGFIRPGMIIAGTDSHSCTYGAFGAFSTGVGTTDMANIFA
TGDLWLRVPATLLFELSGNLPQDISAKDIMLFILSQIGCHGATGKVIEFRGSIIEQLSID
ERMTLANMAIEAGAICGLIAPDHKTIEYLQQKSTKKEFNIVTSDPDTEYEQVYQFDLSNL
EPQIARPPKPDQVVNISELEEITITKAFIGSCTGGKLNDLAQAAKVLKGHKVASQVSLFV
VPASQEVRQQAEKLGYLAIFQQAGAQILKSGCGACINAGIGVLEREEIGIYATNRNFKGR
SGDPTGKNYLASPRIVAISAIKGKITNQID
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaataagtttgaaaacattctttatttaggagacgacatcaatactgatgatattatt
cctgccaaacgaggcacaaatggcgatctagaacacttggcaagatatgctttagaatat
ctgattggagaaaataaattaaaagaatacaatattatcgaagctggagataactttggt
tgtggttcgagtcgagaatacgcacctttagcaattaaagcagcaggaattaaaaaagtt
cgcgctcgttcttttgcagaaattttttatcgcaatagtattaatatcggtctaaattta
gaaattattggcgaaaatcaaaacaattctgttattgaagctatttctcaggcagggggt
ttaattgcttttaatcaacaacgtcttcagggtaaagttactatccctcctagtcacacc
aaacctcgcccgatgacaatagcagagaaattgttagccaaagcttcgggaaatcaatac
gtacaaccaggagaagtaatttttgccaaagtagatttagctatgtcccatgatgcgatc
gcttttcccgtaggacaattattttatcagcattttggtcaggatgctaaagtttgggat
gctaaccgtgttgtcttagttgcggatcattttattcaaattaacgagatcaggaaagat
ttaggcgcagttgagatgtatcaaggcatggttgattttgccaagcagcaaggttgtcat
ttattagatttagttgcttcaggagaagcgcagggtatttgtcatgttttattacccgaa
caaggtttcattcgcccaggcatgattattgctggcacagactcccacagttgcacctat
ggtgcttttggggcattttccactggagtaggtactactgatatggcaaatatttttgct
acaggcgatctatggttgcgtgttcctgctactttattgtttgagttatcaggtaatctt
cctcaagatatcagcgcgaaggatattatgctgtttatccttagtcaaattggttgtcat
ggtgcgacaggtaaagtaattgaatttcggggaagtataattgaacagttatcgattgat
gaaagaatgactcttgccaacatggcgatcgaagctggggcaatctgtggtttaatagca
cctgatcataaaactattgaatatcttcaacaaaaaagtacaaaaaaagaatttaatata
gttaccagtgatccagatacagagtacgaacaagtttatcaatttgatctcagtaactta
gaacctcaaattgcccgtccacccaaaccagatcaagtagttaatattagtgagttagaa
gaaatcacaatcactaaagcttttattggttcttgtactggcggtaaactaaacgatctt
gctcaagctgccaaagtattaaaaggacacaaagttgcttctcaagtcagtttatttgtt
gttcctgcttctcaagaagttcgtcaacaagctgaaaaattaggatatttagcaatattt
caacaagcaggggcgcaaatccttaaatctggctgtggtgcttgtattaatgcaggaata
ggcgttctagagcgagaagaaataggtatttatgcaaccaatcgcaatttcaaaggacgt
agtggcgatcctactggaaaaaattatttagcttctcccagaatagtcgcaatttcagcc
ataaaaggtaaaattactaaccagattgattga

DBGET integrated database retrieval system