KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5679
Entry
SCAT_5679         CDS       T01646                                 

Symbol
cmcI
Name
(GenBank) Cephalosporin-7-alpha-hydroxylase
  KO
K18062  cephamycin C biosynthesis protein
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00311  Penicillin and cephalosporin biosynthesis
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
Module
sct_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SCAT_5679 (cmcI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sct01008]
    SCAT_5679 (cmcI)
Polyketide biosynthesis proteins [BR:sct01008]
 Nonribosomal peptide tailoring proteins
  Others
   SCAT_5679 (cmcI)
SSDB
Motif
Pfam: CmcI Methyltransf_24 DUF1641 VARLMGL
Other DBs
NCBI-ProteinID: CCB78366
Position
6105352..6106062
AA seq 236 aa
MNDWSRANFLDLNTFRGLGEDPVYHPPVLTDRPREWPLDQWADAPRDLGYPDFARYQWRG
LRMLKDPDTQAAYHDLLWELRPRTVVELGVYSGGSLVWFRDLARLMGLDCQVIGIDKDLS
RCQIPDTERTGITLREADCSQLETFEPLRGAAHPLIFIDDAHSNTFAIMKWAVGHLLEEG
DYFIVEDMIPYWHRYSPALLTQYLASFRDVLAMDMVYANASSQLDRGVFRRSTTKE
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaacgactggtcccgtgcgaacttcctcgatttgaacacgttccgcgggctgggcgag
gacccggtctatcatcccccggtactgaccgaccgaccgcgtgaatggccactcgaccag
tgggccgacgcaccccgcgacctcggatatccggatttcgcccgctatcaatggcgggga
ctgcggatgctcaaggacccggacacccaggccgcctaccacgacctgctgtgggaactg
cgcccgcgcaccgtcgtcgaactcggggtgtacagcggcggctccctggtctggttccgc
gacctggcccggctcatgggactcgactgccaggtcatcggcatcgacaaggacctgtcc
cgctgccagatccccgacaccgagcgcaccgggatcaccctgcgggaagccgactgctcc
cagctggagacgttcgaaccgctgcggggcgccgcccatccgctgatcttcatcgacgac
gcgcacagcaacacgttcgccatcatgaaatgggccgtcggccacctgctggaggagggc
gactacttcatcgtcgaggacatgatcccctactggcaccgctacagccccgcgctcctc
acccagtacctcgcctccttccgcgacgtgctggccatggacatggtgtacgccaacgcc
agctcccaactggaccgcggcgtcttccgccgttcgacgacgaaggagtag

DBGET integrated database retrieval system