KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_56790
Entry
SCATT_56790       CDS       T02095                                 

Name
(GenBank) hydroxylase
  KO
K18062  cephamycin C biosynthesis protein
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00311  Penicillin and cephalosporin biosynthesis
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
Module
scy_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SCATT_56790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:scy01008]
    SCATT_56790
Polyketide biosynthesis proteins [BR:scy01008]
 Nonribosomal peptide tailoring proteins
  Others
   SCATT_56790
SSDB
Motif
Pfam: CmcI Methyltransf_24 DUF1641 VARLMGL
Other DBs
NCBI-ProteinID: AEW98050
UniProt: F8LFQ4
Position
6105371..6106081
AA seq 236 aa
MNDWSRANFLDLNTFRGLGEDPVYHPPVLTDRPREWPLDQWADAPRDLGYPDFARYQWRG
LRMLKDPDTQAAYHDLLWELRPRTVVELGVYSGGSLVWFRDLARLMGLDCQVIGIDKDLS
RCQIPDTERTGITLREADCSQLETFEPLRGAAHPLIFIDDAHSNTFAIMKWAVGHLLEEG
DYFIVEDMIPYWHRYSPALLTQYLASFRDVLAMDMVYANASSQLDRGVFRRSTTKE
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaacgactggtcccgtgcgaacttcctcgatttgaacacgttccgcgggctgggcgag
gacccggtctatcatcccccggtactgaccgaccgaccgcgtgaatggccactcgaccag
tgggccgacgcaccccgcgacctcggatatccggatttcgcccgctatcaatggcgggga
ctgcggatgctcaaggacccggacacccaggccgcctaccacgacctgctgtgggaactg
cgcccgcgcaccgtcgtcgaactcggggtgtacagcggcggctccctggtctggttccgc
gacctggcccggctcatgggactcgactgccaggtcatcggcatcgacaaggacctgtcc
cgctgccagatccccgacaccgagcgcaccgggatcaccctgcgggaagccgactgctcc
cagctggagacgttcgaaccgctgcggggcgccgcccatccgctgatcttcatcgacgac
gcgcacagcaacacgttcgccatcatgaaatgggccgtcggccacctgctggaggagggc
gactacttcatcgtcgaggacatgatcccctactggcaccgctacagccccgcgctcctc
acccagtacctcgcctccttccgcgacgtgctggccatggacatggtgtacgccaacgcc
agctcccaactggaccgcggcgtcttccgccgttcgacgacgaaggagtag

DBGET integrated database retrieval system