KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p09090
Entry
SCATT_p09090      CDS       T02095                                 
Name
(GenBank) putative hydroxylase
  KO
K18565  2-oxoglutarate-dependent dioxygenase [EC:1.14.20.-]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00332  Carbapenem biosynthesis
scy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SCATT_p09090
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.-
     SCATT_p09090
SSDB
Motif
Pfam: PhyH 2OG-FeII_Oxy_5
Other DBs
NCBI-ProteinID: AEW99102
UniProt: F8JND5
Position
pSCATT:903682..904473
AA seq 263 aa
MPVTQSIQALSDELRRDGVVALDDLVPESVLEVMRRGCAELIGRTERMRISTEEWQLEAE
GEGGGWAARAAGKECIPGKVRIIGRAHEHSADLAAVPDLVGLNEKLIEPLHGLPGDFYDC
FLWAKPSRVGSQKPWHQDAIFLADEWHEKYVDVYTIWIAVDDAREDNGCLRFLPGSHRER
KLYEPDGIDPGDIFASPREPSLDIARIWPGLTPVTLPRKAGSALLFNGYVAHTSAPNTTE
DDRRAVSYCYSLPRHPAGPESGR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgccggtgacccagtcgatccaggccctgtccgacgaactgcggcgcgacggtgtcgtg
gcgctggacgacctggtgcccgaatccgtactcgaggtgatgcgccgcggctgcgccgaa
ctgatcggccgcaccgagcggatgcgcatcagcaccgaggaatggcagctggaggccgag
ggggagggcggcggatgggccgcccgggcggccggcaaggagtgcatacccggcaaggtg
cgcatcatcggccgcgcccacgaacactccgccgacctcgccgccgtccccgacctcgtc
ggcctcaacgagaagctgatcgaaccgctgcacggcctgcccggtgacttctacgactgc
ttcctgtgggccaagccctcccgggtcggctcccagaaaccctggcaccaggacgccatc
ttcctggccgacgagtggcacgagaagtacgtggacgtctacaccatctggatcgcggtg
gacgacgcccgcgaggacaacggctgcctgcgcttcctgcccggctcccaccgggaacgc
aaactctacgaaccggacggcatcgaccccggcgacatcttcgcctcaccgcgcgaaccg
tccctggacatcgcacgcatctggcccggcctcaccccggtcaccctgccccgcaaggcc
ggctcggcgctgctgttcaacggctacgtcgcccacacctcggcgcccaacaccaccgag
gacgaccggcgtgccgtctcctactgctattcgctgccccgccaccccgccgggccggag
agcggacggtga

DBGET integrated database retrieval system