KEGG   Streptomyces cyanogenus: S1361_05090
Entry
S1361_05090       CDS       T07416                                 

Symbol
eryA2
Name
(GenBank) Erythronolide synthase, modules 3 and 4
  KO
K24556  tylactone synthase 3
Organism
scyg  Streptomyces cyanogenus
Pathway
scyg01052  Type I polyketide structures
scyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scyg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    S1361_05090 (eryA2)
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    S1361_05090 (eryA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:scyg01008]
    S1361_05090 (eryA2)
Polyketide biosynthesis proteins [BR:scyg01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   cis-AT PKS
    Tylactone synthase
     S1361_05090 (eryA2)
SSDB
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C ADH_zinc_N_2 KAsynt_C_assoc ADH_zinc_N PP-binding adh_short Docking Thiolase_N ADH_N Epimerase Polysacc_synt_2 ACP_syn_III GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: QTD96714
Position
1164338..1170883
AA seq 2181 aa
MSNEDRLRDYLKRVTAELHQTRRRLDAAETGIAEPIAVVSMACRYPGGVRSPEDLWHLLT
HAGDAIGDFPTRRGWDLDNLFDPDPDTTGTSYARQGGFLHDADHFDAEFFGISPREALTI
DPQQRLLLETAWETLERAGLDPTRLRGSRTGVFTGVMYSDYGARLVHDAPGEVEAYLGTG
SAHSVASGRVSYTFGLEGPAVSVDTACSSSLVAMHLAAQALRTGECELALAGGVTVMATP
TTFVEFSRQRGLAADSRVKAFAAAADGTALAEGSALVLLERLSDAQRNGHPVLAVIRGSA
VNQDGASSQLSAPNGPSQQRVIHQALTNAGLTPDLIDAVEAHGTGTTLGDPIEAQALLAT
YGQNRTTDQPLWLGSVKSNIGHTQAAAGIAGVIKMVQAIHHGVLPKTLHINEPTPHVDWE
SGAVKLLTEQTPWPDTGHPRRAAVSSFGISGTNAHLILEAAPPSTTTNQHTEQPPADTPL
PYLLSAKTQTALRTQATRLHHHLTHHPHLDTTAVARTLATTRTHFDHRAAVIATDTTDLL
NGLTTLANGETAPHTLQGRTTEGGVVFVFPGQGSQWPGMASELLASSAPFREKAEECDAA
LREFLDWSVLDVLSGEPGAPSFDRVDVVQPVLFTMMVSLAAVWRAGGVEPSAVVGHSQGE
IAAAYVAGGLSLEDAARVVALRSRAWLRLAGRGGMAAVSLGAPELRPRLERWGERLSVAA
VNSPGTAAVAGEPEALRELVAELHGEGVQARLIPGIDTAGHSAQVDVFHDHLSEVLAPVA
PRSSSVPFYSTVTGALLDTSGLDAAYWYRNMREPVDFEAATRALLADGHRVFLETSPHPM
LAASLQETAGDADADVAVLHTLRRDHGDRTRIITALADAHLQGVAVDWPAVLGAGRTVPL
PTYGFQYQPHWLDAPITADAAATGLTPTDHPLLSALVELPDGQGYVFTGRLSLQTHPWLA
GHAVLEQVLLPGTAFVDVLLHAGAHSGCGRIGELTLQAPLVLPDRGAVHLRVTVGATEDD
GRQSCTVHSRPADAEPGTPWLVHATAVLEPEGAPDAFDFGTWPPADATALDHTDLYDRLA
GIGLAYGAPFRGLRGAWWDGTAVYADVVLEEPGDPAGYGVHPALLDAALHSIGLDTADGG
TGGYVAAGVQLPFAWNDVRLYATGASRLRVRLTRTGDDTVALDVADTSGTPVAAIGSLTM
RPLSTDLLSAARPDRHDALFQLDWTAVPVPARAAADGPIAVVGDGLPTAADAVGSVPVYA
DLTALVRAVDEGAPVPESVLVLAPGRTDEDPAHRTRVALDAVLGLLQGWLADDRFAGSRL
AVLTDRAVAVTDQEADRDLSQAAIWGLVRTAQSENPDRIVLVDLDGTDRSTALVTAALAT
GEPQLAVREGVFHAPRLARAGASRALELPGDRTWRIDVAEPGTLESLAAVDNPAAQRPLA
DGEVRISVRAAGLNFRDALVALGMVPGQEIMGSEAAGVVVETGPGVSGIAVGDRVMGLFT
GALGPLAVTDHRLVMPVPAGWSNSQAASTPVVFLTAYYGLKHLANLRPGQRVLIHTATGG
VGMAAVQLARHLGAEIFTTASLPKQHLLRADGFAEDHIADSRTLDFADEFLAATGGEGVD
VVLNSLAHEFVDASLRLLPRGGHFLEMGKTDRRDPSEVAAAHPGVRYRTFNLDSDGPEHV
QEMLAELAGLFARGALRPLPYTAWDVRTAPDALRYLGQARHTGKLVLTLPRALDPDGTAL
VVGGTGTLGSLTARHLVTEHGIRRMLLTSRQGENAETAGELRADLAALGAEVTIAACDAA
DPEALAALLTSVPDAHPLTVVVHAAAVLDDAVLPALTPERVDTVLRPKIDAAWNLHQLTK
DLDIAAFVLFSSAAGVLGNAGQAGYAAANTFLDALAQHRRSLGLPATSLAWGLWEQTSQL
TAQLQHADRARLARASITAMPTAQALSLLDAALGSYRAVAVPVRFDLGVLRSLAAAGTLP
PILRGLVRSPGRRAIGSGPAQDTPAEDWAQRLSGITPDRQLDLLVQLVRTNAAVVLGHSD
HSSIDESRAFKELGFDSLTAVELRNRLGKAVGLRLPSTVVFDNPTPTALAARLHSELAPR
GAAAHQVVLDGLERLEKLALAAAADQDVRDEISGRVRDFLFRLDQMDVPGARSGAAPEAD
VAGLIDSASDDEIFAFIENEL
NT seq 6546 nt   +upstreamnt  +downstreamnt
atgtcgaatgaggaccggctgcgcgactacctcaagcgtgtgaccgcggaactgcaccag
acgcgccggcggctggacgcggccgagacggggatcgccgagccgatcgccgtggtgtcg
atggcctgccgctaccccggcggcgtccgctcccccgaggacctgtggcacctgctcacc
cacgccggcgacgccatcggcgacttccccacccgacgcggctgggacctcgacaacctc
ttcgaccccgaccccgacaccaccggcacgagctacgcccgccaaggcggcttcctccac
gacgccgaccacttcgacgccgagttcttcggcatcagcccccgcgaagccctcaccatc
gacccccagcagcgcctcctgctcgaaaccgcctgggaaaccctcgaacgcgccggcctg
gaccccacccggctccgcggcagccgcaccggcgtcttcaccggcgtcatgtacagcgac
tacggcgcacgcctcgtccacgacgctccgggggaggtcgaggcctacttgggcacgggc
agcgcccacagtgtcgcgtcgggacgggtgtcgtacaccttcggcctcgaaggccccgcc
gtcagcgtggacaccgcgtgctcgtcctcgctcgtcgcgatgcacctggcggcgcaggca
ctgcgcaccggcgagtgcgaactcgccctcgccggcggagtcaccgtcatggccacgccc
accactttcgtggagttcagccggcagcgcgggctcgccgcggacagccgggtcaaggcg
ttcgcggcggccgccgacggcacggccctggccgagggttccgcgctggtgctgctggag
cggctgtcggacgcccagcgcaacggtcaccccgtgctcgccgtcatccgcggctcggcc
gtcaaccaggacggcgccagcagccagctcagcgcccccaacggcccctcccagcaacgc
gtcatccaccaggccctgaccaacgcaggcctcacacccgacctgatcgacgcggtggaa
gcacacggcaccggcaccaccctcggcgaccccatcgaagcccaggccctcctcgccacc
tacggccagaaccggaccaccgaccaacccctctggctcggctccgtcaaatccaacatc
ggccacacccaagccgccgcaggcatcgccggcgtcatcaaaatggtccaagccatccac
cacggcgtgctgcccaagaccctccacatcaacgaacccacaccccacgtcgactgggaa
tcaggcgcggtcaaactgctcaccgagcaaaccccctggcccgacaccggccacccccgc
cgcgccgccgtctcctccttcggcatcagcggcaccaacgcccacctcatcctcgaagca
gcacccccatccaccaccaccaaccagcacaccgaacaaccccccgcagacacccccctg
ccctacctcctgtccgcaaagacccaaaccgccctgcgcacccaagccacccgcctgcac
caccacctcacccaccacccccacctcgacaccaccgccgtcgcccggacactcgccacc
acccgcacccacttcgaccaccgcgccgccgtcatcgccaccgacaccaccgacctgctc
aacggcctcaccacactggccaacggcgaaacagccccccacaccctgcaaggacggacg
acggagggcggagtcgtcttcgtcttccccggccagggctcccagtggcccggaatggcg
agcgaactcctcgcctcctcggccccgttccgggagaaggccgaggagtgcgacgccgcg
ctgagggagttcctggactggtcggtactggacgtgctgagcggtgagcccggcgcgccg
tcgttcgaccgggtcgacgtggtgcagccggttctgttcacgatgatggtgtcgctcgcc
gccgtgtggcgggcgggcggcgtcgagccgtccgcggtggtcgggcactcccagggtgag
atcgccgccgcgtacgtcgcgggcggtctgtcgctggaggacgccgcccgcgtcgtggcg
ctgcgcagtcgggcctggctgcggctggccgggcgcggcggcatggcggccgtctcgctc
ggcgcgccggagctgcgaccccgcctggagcgctggggcgaacggctctcggtcgccgcc
gtgaacagcccggggacggccgcggtggccggtgagccggaggccttgcgggaactggtc
gcggagctccacggggagggcgtacaggcgcgcttgatccccggtatcgacaccgccggg
cactccgcgcaggtggacgtcttccacgaccacctctccgaggtactggccccggtggct
ccgcgctcctcgtcggtgccgttctactcgacggtgaccggcgcactgctcgacaccagc
gggctcgacgccgcctactggtaccgcaacatgcgcgagccggtggacttcgaggcggcg
acccgagcgctgctggccgacgggcaccgggtgttcctggagaccagtccgcatcccatg
ctggccgcgtcgctgcaggagacggcgggggacgcggacgccgacgtcgccgtactgcac
acgctgcgacgcgaccacggcgaccggacgcggatcatcaccgcactcgccgacgcccat
ctgcagggagtcgccgtggactggccggccgtgctgggcgcgggtcggaccgtgccgctg
cccacgtatggcttccagtaccagccgcactggctggacgcgccgatcaccgcggatgcc
gccgccaccggactgacaccgaccgatcacccgctgctgagcgcgctcgtggaactcccc
gacggccaggggtacgtgttcacgggccgtctctccctccagacacatccgtggctggcc
gggcacgccgtcctggaacaggtgctgctgccggggaccgcgttcgtggacgtcctgctg
cacgccggtgctcacagcggctgcggtcggatcggcgaactcactcttcaggcaccgctg
gtgctgcccgatcggggagccgtccaccttcgggtcacggtgggcgccacggaggacgac
ggccggcagagctgcaccgtccactcgcgccccgcggacgccgagccgggaacgccgtgg
ctggtgcacgccacggccgtactcgaaccggagggcgcgcccgacgccttcgacttcggg
acctggccgccggccgacgccaccgcactcgaccacacggacctgtacgaccggctggcc
gggatcggcctggcctacggggccccgttccgggggctgcgcggcgcctggtgggacggg
acggcggtgtacgccgacgtcgtgctggaggagccgggcgacccggccgggtacggcgtc
caccccgcactcctggacgccgcgctgcactcgatcggcctggacaccgccgacggcgga
acgggcggctacgtggccgcaggggtgcagctgccgttcgcctggaacgacgtcaggctg
tacgccaccggcgcgtcccggctccgcgtacggctgacccgcacaggcgacgacacggtg
gccctggatgtggccgacacatcgggcacgccggtcgccgccatcgggtcgctcaccatg
cgtccgctcagcaccgatctgctgtccgccgcgcggcccgaccgtcacgacgcgctgttc
cagctggactggacggccgttccggtcccggcccgagccgccgcggacgggccgatcgcc
gtcgtcggcgacgggctgccgaccgccgccgacgcggtgggttcggtgccggtgtatgcg
gacctgaccgcgctggtgcgggcggtggacgagggtgccccggttccggaaagcgtcctc
gtcctcgcccccggacgtacggacgaggaccctgcccaccgtacccgggtggcgttggac
gccgtgctcggcctgctccagggctggctggcggacgaccgtttcgccggcagccgactg
gccgtcctcaccgaccgggcggtcgccgtgaccgaccaggaggcggaccgtgacctgtcg
caggccgccatctggggcctggtgcgcacggcgcagtcggagaaccccgaccggatcgta
ctggtcgacctcgacggcaccgaccggtccaccgcactggtgaccgcggcactggcgacc
ggtgaaccccaactcgccgtgcgtgaaggggtgttccacgcaccgcggctggcccgcgcc
ggagcctctcgggcgctggagctgcccggggaccgtacgtggcggatcgacgtggccgag
cccggcaccctggagtcgcttgcggcggtcgacaacccggcggcacaacggccgctggcg
gacggagaggtcaggatctccgtacgggcggccggactgaacttccgggacgcgctggtc
gcgctgggcatggtgcccggacaggagatcatgggcagcgaggcggccggcgtggtcgtc
gagaccggtcccggtgtctccggcatcgcggtgggcgatcgggtcatgggtctgttcacc
ggcgcgctcgggccgctcgcggtcaccgaccaccggctggtcatgccggtacccgccggc
tggagcaactcccaggcggcatcgaccccggtggtcttcctcacggcctactacggtctc
aagcacctggcaaacctgcgtcccgggcagcgcgtgctgattcacaccgcgaccggcggc
gtcggaatggccgccgtccaactcgcccggcacctcggtgcggagatcttcaccaccgcc
tcccttcccaagcagcacctgctgcgggccgacgggttcgccgaggaccacatcgccgac
tcccgcacactggacttcgcggacgagttcctggcggccaccggcggcgagggcgtcgac
gtcgttctcaactccctggcccacgagttcgtcgacgcctcgctgcggctgttgccgcgc
gggggccacttcctggaaatgggcaagaccgaccggcgcgacccctccgaagtggccgcc
gctcatcccggggtgcggtacaggacgttcaacctggactccgacggacccgagcacgtc
caggagatgctggccgagctggccggtctcttcgcgcgcggtgcactgcgcccgctgccc
tacaccgcatgggacgtgcgcacggcacccgacgccctgcggtacctgggccaggcacgc
cacaccggcaagctggtactcacccttccgcgcgccctcgaccccgacgggaccgcgctc
gtcgtcggtggcaccggaactctggggagtctgactgcccggcacctggtgaccgaacac
ggcatccgccgcatgctgctgaccagtcgtcagggcgagaatgccgagacagccggggaa
ctgcgggccgacctggccgctctgggcgccgaggtcaccatcgccgcctgcgacgccgcg
gaccccgaggccctggcagcgctgctcacctcggtccccgacgcccatccgctcacggtc
gtagtgcacgccgccgccgtcctcgacgacgccgttctccccgccctgacacccgagcgt
gtagacaccgtcctgcgtccgaagatcgacgccgcctggaacctgcaccagctgacgaag
gacctcgacatcgccgccttcgtcctgttctcctccgccgcgggtgtgctcggcaacgcg
gggcaggcgggctacgccgctgccaacaccttcctcgacgccctggcccagcaccgcagg
tccctcggcctgcccgccacctcgctcgcctggggcctgtgggaacagaccagccagctc
accgcacagctccagcatgccgaccgggcacggctggcccgggccagcatcacggccatg
ccgacggcccaggccctgtccctgctcgacgccgcgctcggctcctaccgtgccgttgcc
gtcccggtccggttcgacctcggggtgctgcgctcgctggccgcggcgggaacgctcccg
ccgatcctgcggggacttgtccgctccccagggcgccgtgcgatcggctccggccccgcg
caggacacgccggccgaggactgggcacagcggctgagcgggatcactcccgaccgacag
ctcgacctcctggtgcagctcgtccgcacgaacgccgccgtggtgctcggccactcggac
cactcgtccatcgacgagtcacgggcgttcaaggagctcggcttcgactcgctgacggcg
gtggaactgcgcaaccggctgggcaaagccgtcggcctgcgcctgccctcgaccgtggtc
ttcgacaacccgacgccgacggcgctcgccgctcgcctgcactcggagctggccccccgg
ggcgcggccgcccaccaggtggtcctggacggcctggagcgcctggagaagctcgcgctc
gccgccgccgcggaccaggacgtacgcgacgagatctccggccgggtgagggacttcctc
ttccggctcgaccagatggacgtccccggtgcccggtccggggccgcgccggaggcggat
gtcgccgggctcatcgactcggccagtgacgacgagatcttcgccttcatcgagaacgag
ctgtaa

DBGET integrated database retrieval system