KEGG   Saccharopolyspora erythraea: SACE_0718
Entry
SACE_0718         CDS       T00492                                 

Gene name
eryCVI
Definition
(GenBank) TDP-desosamine-N-dimethyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00523  Polyketide sugar unit biosynthesis
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
Module
sen_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SACE_0718 (eryCVI)
Enzymes [BR:sen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     SACE_0718 (eryCVI)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran MetW NodS CMAS Methyltransf_15 RrnaAD
Other DBs
NCBI-ProteinID: CAM00059
Kitasato: SACE_0718
Cambridge: SACE_0718
UniProt: A4F7N5
Position
complement(784738..785451)
AA seq 237 aa
MYEGGFAELYDRFYRGRGKDYAAEAAQVARLVRDRLPSASSLLDVACGTGTHLRRFADLF
DDVTGLELSAAMIEVARPQLGGIPVLQGDMRDFALDREFDAVTCMFSSIGHMRDGAELDQ
ALASFARHLAPGGVVVVEPWWFPEDFLDGYVAGDVVRDGDLTISRVSHSVRAGGATRMEI
HWVVADAVNGPRHHVEHYEITLFERQQYEKAFTAAGCAVQYLEGGPSGRGLFVGVRG
NT seq 714 nt   +upstreamnt  +downstreamnt
atgtacgagggcgggttcgccgagctttacgaccggttctaccgcggccggggcaaggac
tacgcggccgaggccgcgcaggtcgcgcggctggtcagagaccgcctgccctcggcttcc
tcgctgctcgacgtggcctgcgggaccggcacccacctgcgccggttcgccgacctcttc
gacgacgtgaccgggctggagctgtcggcggcgatgatcgaggtcgcccggccgcagctc
ggcggcatcccggtgctgcagggcgacatgcgcgacttcgcgctggatcgcgagttcgac
gccgtcacctgcatgttcagctccatcgggcacatgcgcgacggcgccgagctggaccag
gcgctggcgtccttcgcccgccacctcgcccccggcggcgtcgtggtggtcgaaccgtgg
tggttcccggaggacttcctcgacggctacgtggccggtgacgtggtgcgcgacggcgac
ctgacgatctcgcgcgtctcgcactccgtgcgcgccggcggcgcgacccggatggagatc
cactgggtcgtggccgacgcggtgaacggtccgcggcaccacgtggagcactacgagatc
acgctcttcgagcggcagcagtacgagaaggccttcaccgcggccggttgcgctgtgcag
tacctggagggcggaccctccggacgcgggttgttcgtcggtgtgcgcggatga

DBGET integrated database retrieval system