KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_01215
Entry
Q786_01215        CDS       T02944                                 

Gene name
dnaE
Definition
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_01215 (dnaE)
   03430 Mismatch repair
    Q786_01215 (dnaE)
   03440 Homologous recombination
    Q786_01215 (dnaE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_01215 (dnaE)
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_01215 (dnaE)
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_01215 (dnaE)
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_01215 (dnaE)
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_01215 (dnaE)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Other DBs
NCBI-ProteinID: AHB43034
Position
280503..283985
AA seq 1160 aa
MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFTNLCGLVKFYGAGHGA
GIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIERDW
LVELKEGLILLSGGRMGDVGRCLLRGNQALVEECVAFYEAHFPERYFLELIRTGRQDEET
YLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDGFTLDDPKRPRNYSPQQYM
RSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQFPTGDMTTEDYLVKKAKEGL
EERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGYFLIVMEFIQWSKDNGVPVGP
GRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVIEHVAD
MYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLVPPDPGMTLAKAFEAEPQ
LPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQ
FDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRREKNGEPPLDIAAIPLDDKKSFDML
QRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREE
LSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEM
AKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPA
EFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVNDEGEIVYGIGAIKG
VGEGPIEAIIDARNQGGYFRELFDLCARTDTKKLNRRVLEKLIMSGAFDRLGPHRAALMN
SLGDALKAADQHAKAEAIGQADMFGVLAEEPEQIEQSYASCQPWPEQVVLDGERETLGLY
LTGHPINQYLKEIERYVGGVRLKDMHPTERGKVTTAAGLVIAARVMVTKRGNRIGICTLD
DRSGRLEVMLFTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLKMTAREVMDIDEAREKY
ARGLAISLTDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRADARARLRFGATWRVSPSD
RLLNDLRGLIGSEQVELEFD
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgtctgaaccacgtttcgttcacctgcgggtgcacagcgactactctatgatcgatggg
ctggcgaagaccgggccgctggtgaaaaaggcggcctcattaggtatgcctgcgctggcg
atcaccgattttaccaacctctgcggtctggtgaagttctacggagcgggtcatggcgcg
ggcattaaacccatcgtcggggcggactttaatgttcacaacgaactgctgggagatgag
ctgactcatctgacggtactggcggcgaataatacgggataccagaacctgacgttgctg
atctcgaaagcgtatcagcgcggctacggcgcggcaggcccgattattgagcgcgactgg
ctggtagagcttaaagaaggtttgatcctgctttccggcgggcgcatgggcgacgtaggc
cgctgtctgctacgcggcaaccaggcgctggtggaggagtgcgttgctttctatgaagcg
cattttcccgaacgctacttcctggaactgatccgtaccggcagacaggatgaagagacc
tatctccatgctgcggttgagctggctgaggcacgtggtttgccggttgtcgcgacaaac
gatgtccgttttcttgaaagcgatgattttgacgcccatgaaattcgtgtcgcgatccac
gacggtttcacgctcgacgatcctaaacgtccacgcaattattcaccgcagcagtatatg
cgcagtgaagaagaaatgtgcgagctgttctccgatattccggaggcgctggaaaatacg
gtggagattgccaaacgctgcaacgtaacggtgcgtctgggtgaatatttcctgccgcag
ttcccgaccggcgatatgaccaccgaagattatctggtcaaaaaagcgaaagaggggctg
gaagagcgtctggctttcctgtttccggacgaagaagagcgcaaaaagcgtcgcccggaa
tatgacgagcgtctggatattgaactacaggttatcaaccagatggggttccctggctac
ttcctcatcgtgatggagtttatccagtggtcaaaagataacggcgtgccggtagggccg
ggacgtggttccggggctggttcgctggtggcctacgcgctgaaaattaccgaccttgat
ccgctggaatttgacctgctgttcgaacgtttcctgaacccggaacgtgtctcgatgcct
gacttcgacgttgacttctgtatggagaaacgcgaccaggtgattgagcacgtcgcagac
atgtacgggcgtgatgcggtatcgcagattatcaccttcggtacgatggcggcgaaagcc
gttatccgcgatgtgggccgcgtgctggggcatccgtacggttttgtggatcgtatctcg
aagctggtgccgcccgatccgggcatgacgctggcaaaagcctttgaagcggaaccgcaa
ctgccggaaatttacgaggcggatgaagaggtcagagcgctgatcgatatggcgcgtaag
cttgaaggcgtcacgcgtaacgccggtaagcacgctggcggcgtggtcatcgcgccgacc
aaaattaccgactttgcgccgctgtactgcgatgaagagggcaagcatccggttacccag
tttgataaaagcgacgtggaatatgccgggctggtgaagttcgacttcctcggtttgcgt
acgctgaccatcatcaactgggcgctggagatgatcaacaagcggcgcgagaaaaacggc
gagccgccgctggatatcgccgccattccgctggacgataaaaaaagcttcgacatgctg
cagcgctcggaaaccacggcggtcttccagcttgaatcgcgcggcatgaaagatctgatc
aaacgtctgcagccagactgctttgaagatatgatcgcactggtggccctgttccgtccc
ggcccgttgcagtcagggatggtagataactttatcgaccgtaagcacggtcgtgaagaa
ctctcttacccggacgttcagtggcagcatgaaagcctgaagccggtactggagccgacc
tacggcatcattctgtatcaggaacaggtgatgcagattgcccaggtactttccgggtat
actctcggcggcgcggatatgctgcgtcgtgcgatgggtaagaaaaagccggaggagatg
gccaaacagcgttccgtttttgaagagggcgcgaaaaagaacggtatcgacggcgaactg
gcgatgaaaatctttgacctggtggagaaattcgccggttacgggtttaacaaatcgcac
tccgccgcttatgcgctggtttcttaccagacgctatggctaaaggcgcactatccggct
gaatttatggcggcggtgatgactgccgatatggacaacaccgagaaggtcgtcggcctg
gtggacgagtgctggcggatgggactgaaaattctgccgccggatattaactccggattg
taccatttccacgttaacgatgagggcgagatcgtctacggtatcggcgcgatcaaaggc
gtcggcgaagggccgatcgaagcgatcatcgacgcgcgtaatcagggcggctatttccgc
gagctgtttgatctgtgcgcgcgaaccgacaccaaaaagctcaaccgccgggtgctggaa
aagctgatcatgtccggggcgttcgaccgcctggggccgcaccgcgccgcgctgatgaac
tcattgggcgatgcgctgaaagccgccgaccagcacgccaaagcggaagctatcggtcag
gcggatatgttcggcgtactggcggaagagccggagcaaatcgagcaatcctatgccagc
tgccagccgtggccggagcaggtggtgttagatggggaacgtgaaacgttggggctgtac
ctgacgggccaccccatcaatcagtatttaaaagaaattgagcgctatgtcggcggggta
aggctcaaagacatgcatccgacagaacgtggtaaagtcaccacggctgcggggctcgtg
attgccgcaagggttatggtcaccaagcgcggcaatcgtatcggcatctgtacgctggat
gaccgttccgggcgtctggaagtgatgttatttaccgacgcgctggataaataccagcag
ttgctggaaaaagaccgcatacttatcgtcagcggacaggtcagctttgatgacttcagc
ggggggcttaaaatgaccgcccgcgaagtgatggatattgacgaagctcgcgaaaaatac
gctcgcgggcttgctatctcgctgacggacaggcaaattgatgaccagcttttaaaccga
ctccgtcagtctctggaaccccaccgctcggggaccattccagtacatctctactatcag
agggcggatgcgcgtgcgcggctgcgttttggcgcaacgtggcgtgtctctccgagcgat
cgtttacttaacgatctgcgtggcctcattggttcggagcaggtggaactggagtttgac
taa

KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_01380
Entry
Q786_01380        CDS       T02944                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_01380
   03430 Mismatch repair
    Q786_01380
   03440 Homologous recombination
    Q786_01380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_01380
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_01380
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_01380
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_01380
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_01380
SSDB
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1 vATP-synt_AC39 HPIP
Other DBs
NCBI-ProteinID: AHB43061
Position
314237..314977
AA seq 246 aa
MTDMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRRLTGNNFHVYLKPDRL
VDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNASFDIGFMDYEFGLLKRD
IPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHGALLDAQILAEVYLA
MTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFASEEELAAHESRLDLVQKKGG
SCLWRA
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccgatatgagcactgcaattacacgacagattgtcctcgataccgaaaccaccggt
atgaaccagataggcgcgcactatgaaggtcacaagattattgagatcggtgcggttgag
gtgataaaccgtcgtctgaccggcaacaattttcatgtttacctgaagccggatcggctg
gtggatccggaagcgtttggcgtacacggtattgccgatgagtttctgctggataagccg
gtttttgctgatgtggtcgatgagtttctcgattatatccgcggcgcggagctggtcatc
cataacgcatcgttcgatatcggctttatggattatgagtttggtctgcttaaacgcgat
attcctaaaaccaatactttctgcaaagttaccgacagcctggcgttggcgcggaaaatg
ttccccggcaagcgtaacagccttgatgcgctgtgttcgcgttatgagatagataatagc
aaacgtactttgcacggcgcattgctcgatgcccagatccttgccgaagtgtatctggcg
atgacgggcgggcaaacgtccatgacgtttgcgatggaaggagagacgcaacggcagcaa
ggtgaagcgaccattcagcgaatcgttcgccaggccagccggttacgggtcgtttttgcc
tctgaggaagagctggctgcgcatgaatcgcggcttgatctggtgcagaaaaagggcgga
agttgcctttggcgggcgtaa

KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_02385
Entry
Q786_02385        CDS       T02944                                 

Definition
(GenBank) DNA polymerase III subunits gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_02385
   03430 Mismatch repair
    Q786_02385
   03440 Homologous recombination
    Q786_02385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_02385
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_02385
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_02385
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_02385
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_02385
SSDB
Motif
Pfam: DNA_pol3_tau_5 DNA_pol3_delta2 DNA_pol3_gamma3 DNA_pol3_tau_4 AAA RuvB_N AAA_5 AAA_22 AAA_18 ResIII DNA_pol3_delta TIP49 AAA_16 AAA_30 AAA_14 AAA_assoc_2 TsaE AAA_19 PIF1 AAA_24
Other DBs
NCBI-ProteinID: AHB43250
Position
522314..524242
AA seq 642 aa
MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAK
GLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDV
EQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAM
LGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPA
ALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFH
PRMPLPEPETPRQSFAPVAPTAVMTPPQVQQQSAPAPQTSPAPLPASTSQVLAARNQLQR
SQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQARPAPSALETAPVKKEAYRWKAT
TPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVAL
NAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALSDLTGTTVELTIVEDDNPAVRTPLE
WRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESIRPI
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgagttatcaggtcttagccagaaaatggcgcccacaaacctttgctgacgtcgtcggc
caggaacatgtgctgaccgcactggcgaacggcttgtcgttagggcgcattcatcacgca
tatcttttttccggcacgcgcggcgtcggtaaaacctctatcgcccggctgctggcgaag
gggctgaactgcgaaaccggtattaccgcgacgccgtgcggcgtttgcgataactgtcgg
gaaattgagcaggggcgttttgtcgatctcattgagattgacgccgcatcgcgtaccaaa
gtcgaagacacccgcgacctgctggataacgtccagtacgcgcctgcgcgcggtcgcttt
aaagtctatctgatcgatgaagtccacatgctgtcgcgccacagctttaatgcgctactt
aaaacgcttgaagagccgccagcgcatgtgaaatttttactggcgaccaccgatccgcag
aagctgccggtgaccattttgtcgcgctgcctacagtttcatctcaaagcgctggatgtt
gaacagattcgccatcagcttgagcatattctcaatgaggaacatatcgctcacgaaccc
cgcgcgttgcagttgttatcacgcgcggctgacggcagcctgcgcgatgcattaagtctg
actgaccaggcgatcgccagcggtgacgggcaggtttcgacgcaggcggtaagcgccatg
ctcggtacgctggacgatgaccaggctttgtcattagtcgaggcagtggttgacgctaac
ggcgaacgcgtcatgtcgcttatcaacgaggcggcggcgcgcggtattgaatgggaagcg
ctgctggtcgaaatgcttagcctgctgcaccgtattgcgatggtgcaactttcgcctgcc
gcgttaggcagcgatatggcggctatcgagcaacggatgcgcgaacttgcccggacggtg
cctcccggcgatcttcagctctattatcagacgttgttgattggtcgcaaagaattgccc
tgggcgccggaccggcggatgggcgttgaaatgacgttactgcgtgcgctggcgtttcac
ccgcgtatgcccttgccggagcctgaaacgccgcggcagtcttttgcgcccgtggcccca
acggcggtaatgacgccgccgcaggtgcagcagcagtcggcgcccgcgccgcagacatcg
ccagcgccgctgccggcatctaccagtcaggtgctggcggcgcgcaatcagctacagcgc
tcgcagggagtaaccaaaacaaaaaagagtgaaccggcagccgcatcccgcgcgcggccg
gtgaataactctgcgctggagcggctggcctcggtttcggagcgcgtacaggcgcgcccg
gcgccgtctgcgctggaaacggcgccagtaaagaaagaggcttatcgctggaaggccacc
acaccggtagtacaaaccaaagaagtggtggctacgccaaaagcgcttaagaaagctctg
gagcatgaaaaaacgccggagctggcggctaaactggcggcggaagcgattgagcgcgat
ccgtgggcggcgcaggtaagccagctttctttgcctaagctggtggagcaggtggcgctt
aatgcctggaaggagcagaacggcaacgcggtttgtctgcatctgcgctcgacgcagcgg
cacctcaattccagcggcgcgcagcaaaagctggcgcaagcgctcagcgatctgacggga
acgacggttgaactgaccatcgttgaagatgataatcccgcggtgcgtacgccgctggaa
tggcgtcaggccatttatgaagagaaactcgcgcaagcgcgtgagtcaattattgcggat
aataacattcagacgctgcgtcgattcttcgacgccgagctggatgaagagagtatccgc
cccatttga

KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_03165
Entry
Q786_03165        CDS       T02944                                 

Gene name
holA
Definition
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_03165 (holA)
   03430 Mismatch repair
    Q786_03165 (holA)
   03440 Homologous recombination
    Q786_03165 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_03165 (holA)
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_03165 (holA)
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_03165 (holA)
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_03165 (holA)
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_03165 (holA)
SSDB
Motif
Pfam: DNA_pol3_delt_C DNA_pol3_delta DNA_pol3_gamma3
Other DBs
NCBI-ProteinID: AHB43401
Position
complement(681289..682320)
AA seq 343 aa
MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAIRLAAASQGFEEHHAFTLDPSTD
WGSLFSLCQAMSLFASRQTLVLQLPENGPNAAMNEQLATLSELLHDDLLLIVRGNKLTKA
QENAAWYTALADRSVQVSCQTPEQAQLPRWVAARAKAQNLQLDDAANQLLCYCYEGNLLA
LAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEG
SEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRPMIGDALQRLHPAQLRQ
AVQLLTRTEITLKQDYGQSVWADLEGLSLLLCHKALADVFIDG
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgatcaggttgtatcctgaacaactccgcgcgcagctcaacgaagggctgcgtgcggca
tatctattattgggcaacgatccgctgctgctgcaggaaagtcaggacgctattcgtctg
gcggctgcgtcgcaaggcttcgaagagcaccacgcttttactctcgatcccagtaccgac
tggggatcgcttttctcactctgccaggcgatgagcctgttcgccagccgtcaaacgctg
gtgctgcaactgccggaaaacgggcctaacgcggcaatgaatgagcaactcgccaccctg
agcgagctgctgcatgacgacctgttattaatagtacgcggaaacaagctcaccaaagcg
caggagaacgccgcctggtataccgcgctggcagaccgtagcgttcaggtcagttgtcag
acgccggagcaggcgcagcttccccgctgggtggccgccagagcgaaagcacagaatttg
caactggatgacgccgcgaaccaactgctgtgctattgctatgagggcaatctgttggcg
ctggcacaggcgctggaacggctgtcgctgctttggcctgacggtaagttaacgcttcct
cgcgtggagcaggccgtcaatgacgccgcccactttacccctttccactgggtggatgcg
ttactgatggggaaaagcaaacgcgcgctgcatatcctgcaacagctacgccttgaaggc
agcgaaccggttattctgctgcgcaccctccagcgagagctgctgctactggtaaatctc
aaacgtcagtccgcgcatacgccgttacgcgcgctgtttgataaacaccgggtctggcaa
aaccgtcgccccatgatcggcgacgcgttgcagcgtctccatcctgcgcagcttcgccag
gccgtgcagttactgacgcgtacagaaattacgctcaaacaggattatggtcagtcggta
tgggcagatcttgaagggctgtcgctcctgctctgccataaggcgctggcagacgtattt
attgatgggtga

KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_05825
Entry
Q786_05825        CDS       T02944                                 

Definition
(GenBank) DNA polymerase III subunit theta
  KO
K02345  DNA polymerase III subunit theta [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_05825
   03430 Mismatch repair
    Q786_05825
   03440 Homologous recombination
    Q786_05825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_05825
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_05825
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_05825
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_05825
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_05825
SSDB
Motif
Pfam: DNA_pol3_theta MMM1
Other DBs
NCBI-ProteinID: AHB43902
Position
complement(1232653..1232883)
AA seq 76 aa
MKTNLAQLEQVEMDKVNVDLAAAGVAFKERYNMPVVAEAVEREQPEHLRAWFRERLIAHR
LASVSLSRLPYEPKVK
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaaaacgaatctggctcagcttgaacaagtggaaatggataaagtcaatgtggacctg
gcggcagccggggtggcatttaaagagcgctacaatatgccagttgtcgcggaggcggtc
gaacgtgagcagccagagcacctacgcgcctggtttcgcgagcggctgattgcccatcgt
ctggcttccgtatcactatcccgactcccttacgaacccaaagttaaataa

KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_09255
Entry
Q786_09255        CDS       T02944                                 

Definition
(GenBank) DNA polymerase III subunit delta'
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_09255
   03430 Mismatch repair
    Q786_09255
   03440 Homologous recombination
    Q786_09255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_09255
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_09255
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_09255
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_09255
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_09255
SSDB
Motif
Pfam: DNA_pol3_delta2 DNApol3-delta_C EPF
Other DBs
NCBI-ProteinID: AHB44561
Position
complement(1928395..1929399)
AA seq 334 aa
MKWYPWLRPAYEKLVESYQAERGHHALLIQALPGMGDEALCYALSRYLLCQQPEGHKSCG
HCRGCQLMQAGTHPDYYTLTPDKGKSSLGVDAVREVSEKLYEHSRLGGAKVVWIADAALL
TDAAANALLKTLEEPPEQTWFFLASPEPARLLATLRSRCRLHHLAPPSESYAMSWLSREV
TASQEALLTALRLNAGSPGAALALLQSERWAQREALCQALMDSLHTGDWYALLTALNHEQ
APARLHWLATLLVDALKRQHGASYLTNVDADAVVAALAGPLSPARIQAILNDVCHCRDQL
LHVTGLNRELVLTDLILRIEHYLQPGTLLPVPHL
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaaatggtatccatggttacggcccgcctatgaaaaactggtagaaagttaccaggcg
gaacgtgggcaccatgcgctactgattcaggccttacctggcatgggcgacgaggcgttg
tgctatgcgctgagccgttatctgttatgccagcagcctgagggccacaaaagctgtggg
cattgccgtggctgtcagcttatgcaggctggcacgcatccggactattacacgctgacg
ccggataaaggcaaaagcagcctcggcgtagatgcggtacgcgaggtcagcgagaaattg
tacgagcactcccgtctgggcggcgcgaaggtggtgtggattgcggatgcggcgctatta
accgacgccgccgccaatgcgttgctcaaaacgctggaagagccgccggagcaaacctgg
tttttccttgccagcccggagcctgctcgtctgttggcgacattacgcagccgctgccgg
ctgcatcatctggcgccgccgtccgaatcgtatgcgatgtcatggctgtcgcgagaagtg
acggcgtcacaagaagcattgctcacggcgctacgtctgaatgcggggtcgcccggcgcc
gcgctggcgctgttgcagtctgaacgctgggcgcagcgtgaggcgctgtgtcaggcgttg
atggacagtttacatacgggcgactggtatgcgttattaacggcgctcaatcatgagcaa
gccccggcgcgcctgcactggctggcgacgctgctggtagacgcgctgaaacgtcagcac
ggcgcgtcgtacctgacaaacgttgatgcggacgcggttgttgccgcgctggcggggccg
ctatccccggcgcgtattcaggcaatcctgaacgatgtttgtcattgtcgtgatcaatta
cttcatgtgaccggattaaaccgcgaactggtattaaccgatctcattctccgcatcgag
cattacctgcaaccaggcaccttgttgcctgttcctcatctttga

KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_18810
Entry
Q786_18810        CDS       T02944                                 

Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_18810
   03430 Mismatch repair
    Q786_18810
   03440 Homologous recombination
    Q786_18810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_18810
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_18810
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_18810
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_18810
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_18810
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Other DBs
NCBI-ProteinID: AHB46362
Position
complement(3928703..3929803)
AA seq 366 aa
MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLS
QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNLD
DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGSELRTVATDGHRLAVC
SMPLEASLPSHSVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTSKLVDGR
FPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQE
EAEEILDVSYGGTEMEIGFNVSYVLDVLNALKCETVRIMLTDSVSSVQIEDAASQSAAYV
VMPMRL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaaatttaccgttgaacgtgaacatttattaaaaccgcttcagcaggtcagcggcccg
ctgggcggtcgtcctacgctgccgattctcggtaacctgctcctccaggtagcggacggt
acgctttctctgaccggcaccgatcttgaaatggagatggtcgcgcgcgttacgctttct
cagccgcatgagccaggcgccactaccgtgccggcgcggaaattctttgatatctgccgc
ggcctgccggagggcgcggagattgccgttcagttggaaggcgatcggatgttggtgcgt
tctggccgtagccgcttctcgctgtctacgctgcctgccgccgatttcccgaatcttgac
gactggcaaagcgaagttgaatttacgctgccgcaggccacgatgaagcgcctgattgaa
gcgacccagttttcgatggcccatcaggatgtgcgctactacttaaacggtatgctgttt
gaaacggaaggtagcgaactgcgcactgtcgcgaccgacggccaccgtctggcggtgtgc
tcaatgccgctggaagcgtctttacccagccactcggtgattgtgccgcgtaaaggcgtg
attgaactgatgcgtatgctcgacggcggcgaaaacccgctgcgcgtgcagatcggcagt
aataatatccgcgcgcacgtcggcgactttatctttacctcgaagctggtggatggtcgc
ttcccggattaccgtcgcgttctgccgaagaatccggataagcatctggaagcgggctgc
gatatcctcaagcaggcgtttgcccgcgcggcaatcctctcgaatgagaaattccgcggc
gtgcgtctgtacgtcagtgagaatcagctcaaaatcaccgccaataacccggagcaggaa
gaagcggaagagattctggatgtgagctacggcgggacggagatggaaatcggctttaac
gtcagttacgtgctggacgtgctcaatgcgctgaagtgcgaaaccgtgcgcattatgctg
acggattccgtatccagcgtacagattgaggatgcggcgtcacagagtgctgcctacgtt
gttatgccaatgaggctgtag

KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_22055
Entry
Q786_22055        CDS       T02944                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_22055
   03430 Mismatch repair
    Q786_22055
   03440 Homologous recombination
    Q786_22055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_22055
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_22055
Enzymes [BR:sens01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q786_22055
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q786_22055
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Q786_22055
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AHB46953
Position
complement(4616764..4617288)
AA seq 174 aa
MPDGAALIRPTGGIMATHFNPPQEAPYMKNATFYLLDNDTTVNGLSAVEQLVCEIAAERW
RAGKRVLIACEDEKQAIRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPR
DILISLRTSFADFATAFTEVVDFVPYEETLKQLARERYKAYRVAGFNLNTATWK
NT seq 525 nt   +upstreamnt  +downstreamnt
ttgccggatggcgctgcgcttatccggcctacgggaggcatcatggcaacgcatttcaat
ccaccacaagaagccccatatatgaagaatgcgacgttctatcttctggacaatgacacc
accgtcaacggtttaagcgccgttgaacaactggtgtgtgaaattgccgcagaacgttgg
cgcgccggcaagcgcgtgctgatcgcctgcgaagatgagaagcaggccattcggctggat
gaagcgctgtgggcaagaccggcggaaagttttgtcccgcacaatctggcaggcgaaggc
ccacgcggcggcgcgccggttgaaatcgcctggccgcaaaaacgcaacagcagcccgcgc
gatattttaatcagcctgcgtacaagctttgcagattttgccaccgctttcacagaagtg
gtagacttcgtcccttacgaagaaactttgaaacaactggcgcgcgaacgctacaaagcc
taccgcgtggctggttttaacctgaatacggcaacctggaaataa

DBGET integrated database retrieval system