KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_05710
Entry
Q786_05710        CDS       T02944                                 

Gene name
ruvC
Definition
(GenBank) Holliday junction resolvase
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Q786_05710 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_05710 (ruvC)
Enzymes [BR:sens01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     Q786_05710 (ruvC)
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Q786_05710 (ruvC)
    RecFOR pathway proteins
     Q786_05710 (ruvC)
SSDB
Motif
Pfam: RuvC DUF3882 NeuB
Other DBs
NCBI-ProteinID: AHB43879
Position
1209187..1209708
AA seq 173 aa
MSIILGIDPGSRITGYGVIRQVGRQLTYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQ
PDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKS
QVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtcgattattctcggtattgaccccggctcgcgcattaccggttatggcgttatccgc
caggtaggtaggcaactgacctatctgggcagcggatgtattcgtaccaaagtcgatgat
ttgccgtctcgtttgaagctcatatacgcaggcgtgacggaaatcatcacgcagttccag
ccggactatttcgctatcgaacaggtgtttatggcgaagaacgccgattcagccctcaag
ctgggacaggcgcgcggcgtcgcgattgtcgccgcggtcaaccaggaactgcccgtgttt
gaatacgcggcgcgtcaggtgaagcaaaccgtcgtcggtattggtagcgcggaaaaaagc
caggtacagcatatggttcgtacgttgctaaagctccccgctaacccgcaggccgatgcc
gcagatgcgctggctatcgccattacgcattgccacgttagccagaacgcgatgcaaatg
agcgagagccgactcaatctggcgcggggaaggttgcgctaa

DBGET integrated database retrieval system