KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_14470
Entry
Q786_14470        CDS       T02944                                 

Gene name
recD
Definition
(GenBank) exonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Q786_14470 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_14470 (recD)
Enzymes [BR:sens01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Q786_14470 (recD)
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Q786_14470 (recD)
SSDB
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 SH3_13 AAA_11 UvrD-helicase DUF2075 AAA_22 AAA_28 AAA_16 MukB PhoH UvrD_C T2SSE CbiA FtsK_SpoIIIE SRP54 DUF6079 Bcl-2 TrwB_AAD_bind AAA NTPase_1
Other DBs
NCBI-ProteinID: AHB45534
Position
complement(3028659..3030494)
AA seq 611 aa
MTIQERLLEAVEQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETATPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRTE
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgacaatccaggagcggttgctggaggccgttgaacaaaaactcttacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacggctacgccaatcgac
tggaaaaagcggttactggcgtctgcggcggttagctgcggcgatagccccgcgccgtta
attctgtgcggcgatcgcctctacctgaatcgcatgtggtgcaacgagcgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcagcgccgaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttcctcttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctgggcgcacagcccggcagtcagcgattacgccatcatgcgggcaacccg
ctgcatctggacgtgctggtggtcgatgaggcatcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactaacagggagcgccattccggcgggg
gccggaacgcaagccgcgtctttacgcgatagcctctgtttgttgcaaaagagctaccgt
ttcggcagcgattctggcatcggcaagctggcggcggcgattaactgcggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagc
agcgacgattatgccgggatgctggatgaagcgctggcgggctatgggcgctacctgcgg
ttgctgcatgagaaagcgacgccggaggcaatcctgcaggctttcaatgagtatcaactg
ctttgcgcgctgcgtgaaggcccatttggcgtgaggggactgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcatccgcactctcgctggtatgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgttggggctatttaacggcgatattggtatt
gcgctcgatcgcggacaggggttacgcgtctggtttgtgatgccggacggcaccatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacaggggtctgaatttgatcacgccgcgctgattttacccagccaacgttcgccggtc
gtgacgcgggagctggtgtataccgcggttacgcgggcgcggcggcgattatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgaacggaacggcgcagcgggtta
gccaccttatttgatgaagtcagtcgtaccgaataa

DBGET integrated database retrieval system