KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_14720
Entry
Q786_14720        CDS       T02944                                 

Definition
(GenBank) ssDNA exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03410  Base excision repair
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Q786_14720
   03430 Mismatch repair
    Q786_14720
   03440 Homologous recombination
    Q786_14720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_14720
Enzymes [BR:sens01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Q786_14720
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     Q786_14720
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Q786_14720
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Q786_14720
SSDB
Motif
Pfam: DHHA1 DHH RecJ_OB PEP-utilizers Glyco_transf_4
Other DBs
NCBI-ProteinID: AHB45582
Position
complement(3084573..3086306)
AA seq 577 aa
MKQQRQLRRREADETTELPADLPPLLRRLYASRGVRSARELERSVKGMLPWQQLSGIDNA
VEILYNAFREGTRIIVVGDFDADGATSTALSVLGMRALGCDNISYLVPNRFEDGYGLSPE
VVDQAKARGAQLIVTVDNGISSHAGVAHAKTLGIPVIVTDHHLPGDTLPDADAIINPNLR
DCEFPSKSLAGVGVAFYLMLALRTFLRDKGWFDERNIAPPNLAELLDLVALGTVADVVPL
DANNRILTWQGLSRIRAGKCRPGIKALLEISNRDPQQLAASDLGFALGPRLNAAGRLDDM
SVGVALLLCDNLGEARVLASELDALNQTRKEIEQGMQAEALILCEKLERSSETLPGGLAM
YHPEWHQGVVGILASRIKERFHRPVIAFAPTGDGTLKGSGRSIQGLHMRDALERLDTLYP
DLMIKFGGHAMAAGLSLEEHKFEQFQQRFGELVTEWLDPALLQGEVISDGPLSAAEMSME
VAQLLRDAGPWGQMFPEPLFDGRFRLLQQRLVGERHLKVMVEPVGGGPLLDGIAFNIDTT
CWPDNGVREVELAYKLDINEFRGNRSLQIIIDDIWPL
NT seq 1734 nt   +upstreamnt  +downstreamnt
gtgaaacaacagagacaacttcgtcggcgcgaggctgatgagacgacggaactccccgcc
gatcttcctccattactacgacgtttatatgccagccggggcgttcgtagcgcccgcgaa
ctggagcgcagcgtgaaaggaatgctgccctggcaacagcttagcggcatagataacgcg
gtggagatcctctacaacgcctttcgcgaaggtacccgcattattgttgttggcgatttt
gacgccgacggcgcgaccagtactgcgctaagcgtattgggaatgcgtgcgttgggatgt
gacaacatcagttatctggtgcctaatcgctttgaggacggctacggtttaagcccggaa
gtggtcgatcaggcgaaggcgcgcggcgcgcagcttatcgtcaccgtagataacggcatc
tcatcccacgccggcgtagcgcatgcaaagacgttggggattccggtgatcgtgaccgat
caccacctgcctggcgacacgttgccggatgccgacgcgattattaatcccaatctgcgc
gactgcgaattcccgtctaagtcgctggcgggcgtcggcgtggcgttttacctgatgctg
gcgttgcgaacatttttgcgcgacaaaggatggttcgacgagcgcaacattgcgccgccg
aatctggcggagctgctggatttagtggcgttgggtacggtagcagacgttgtgccgctg
gacgctaacaaccgtattctgacctggcaagggctaagtcgtattcgtgccgggaaatgc
cgtccgggaattaaagcgttgctggagatatcgaatcgcgatccgcagcagcttgccgcc
agtgatttaggcttcgcgttggggcctcgcctgaatgccgccggcaggctggatgatatg
tccgttggcgtggcgttactgttgtgcgataacctcggcgaagcgcgtgttctggccagc
gagctggatgcgcttaaccagacgcgcaaagaaatagagcaggggatgcaggcggaagcg
cttatcctgtgcgaaaagcttgagcgcagtagtgaaacgcttccgggcggtctggcgatg
tatcatcctgagtggcatcagggcgtggtcggaattctggcgtcgcgcattaaagagcgt
tttcaccgcccggtgatcgcctttgcgcctacgggcgacggcacgctaaaaggctcaggc
cgttcgattcaggggttgcatatgcgcgatgcgctggaaaggctggataccctttaccct
gatctgatgatcaagttcggcggtcatgcgatggcggcgggattgtcgctggaagagcat
aaattcgagcagtttcagcaacgttttggcgagctggtgacggaatggctcgatcctgcc
ctgttgcaaggcgaagtgatctccgatggtccattaagcgcggcggagatgtctatggaa
gtggcgcaactgttgcgggatgccggaccgtgggggcaaatgttcccggaaccgttattc
gatggtcgtttccgtctgctacaacagcgtctggtgggcgagcgccacctcaaggtgatg
gtggagcccgtcggcggcggcccgctgttggatggcatcgcatttaatattgatacgacc
tgttggccggataacggcgtgcgggaggtagaactggcttataaactggacattaacgag
tttcgcggcaaccgtagtttacagattattatcgatgatatttggccgctatga

DBGET integrated database retrieval system