KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_18310
Entry
Q786_18310        CDS       T02944                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Q786_18310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_18310
Enzymes [BR:sens01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Q786_18310
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Q786_18310
SSDB
Motif
Pfam: RecG_wedge DEAD Helicase_C ResIII RecG_C tRNA_anti-codon SecA_DEAD AAA_30 DUF2075 SNF2-rel_dom Helicase_RecD IstB_IS21 PhoH
Other DBs
NCBI-ProteinID: AHB46268
Position
3821738..3823819
AA seq 693 aa
MSGRLLDTVPLNSLTGVGAAQSSKLAKIGLHTVQDLLLHLPLRYEDRTHLYPIGELLPGI
YATVEGEVLNCNITFGGRRMMTCQISDGSGILTMRFFNFNAAMKNSLATGRRVLAYGEAK
RGKYGAEMIHPEYRLQGDLSTPELQETLTPVYPTTEGVKQATLRKLTDQALELLDTCAIA
ELLPPELAQGMMSLPEALRTLHRPPPTLQLADLETGKHPAQRRLILEELLAHNLSMLALR
AGAQRYHAQPLSTNNILKDKLLASLPFTPTSAQARVVAEIERDMALDVPMMRLVQGDVGS
GKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRNWFEPLGVEVGWLAGKQKGKAR
QAQQEAIASGQVQMIVGTHAIFQEQVQFNGLALVIIDEQHRFGVHQRLALWEKGQQQGFH
PHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPVTTVAIPDTRRHEIIDRVRNACT
TEGRQAYWVCTLIEESDLLEAQAAEATWEELKLALPELNIGLVHGRMKPAEKQAVMQAFK
QGELHLLVATTVIEVGVDVPNSSLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKS
PLSKTAQKRLQVLRDSNDGFVIAQKDLEIRGPGELLGTRQTGNAEFKVADLLRDQAMIPE
VQRIARHIHERYPQQAQALIERWMPETERYSNA
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgtcaggccgcttgttagacactgttccgctcaattccctgacaggcgtcggcgcagcg
caaagcagtaaactggcgaaaattggcctgcataccgtgcaggacctcctgctccacctc
cctctgcgttacgaagaccgtacccatctctaccccattggcgaactgctgcctggcatc
tacgccaccgttgaaggtgaagtgctgaactgcaatatcactttcggcggtcgtcggatg
atgacctgccagattagcgacggttccggcattcttaccatgcgctttttcaattttaac
gcggcgatgaaaaacagcctggcgacgggacgacgtgtgctggcctacggggaagcgaag
cgcggcaagtatggcgcagagatgatccatccggaatatcgcctgcagggcgatctcagc
acgccggaacttcaggaaacgctcacccccgtctatccgaccaccgagggcgtgaagcaa
gcgacactgcgcaagcttaccgatcaggcactggagttgctcgacacctgcgccattgcc
gaactactgccgccggaactggcgcagggtatgatgagcctgccggaggcgctacgtacc
ttgcatcgcccgccgccgacgctccagctcgccgatttagaaaccggcaaacacccggca
cagcggcggcttattcttgaagagctactggcgcataatctcagtatgctggcgcttcgc
gcaggcgcgcagcgctatcacgctcagccgctaagtaccaacaacatattgaaagacaag
ctgctggcgtcgttgccgtttacacccaccagcgcgcaggcgcgggtggtggcagagatc
gaacgtgatatggcgctggatgtgccgatgatgcgtctggttcagggcgacgtcggttca
gggaaaacgctggttgccgccctggcggcgctacgcgccatcgctcatggtaagcaggtg
gcgctgatggcgccgaccgaattgctggctgaacagcacgcaaataatttccgcaactgg
ttcgaaccgttgggcgttgaagtgggttggctggcaggtaagcaaaaaggtaaagcgcgt
caggcgcagcaagaggctattgccagcggtcaggtgcagatgattgtcggcacccacgct
atctttcaggaacaggtgcagtttaacgggctggcgctggtcattatcgatgagcagcac
cgctttggcgtccaccagcggctggcattgtgggaaaaaggccagcagcagggctttcat
ccgcatcagttgattatgaccgcaacgcccattccgcgcaccctggcgatgactgcctac
gccgatctcgatacctcggtgattgacgagctaccaccgggccgtacccctgtcactacc
gttgcgattccggatacccgtcgccatgaaatcattgatcgtgtgcgcaacgcctgcaca
accgaaggccgtcaggcctactgggtctgtacgctgattgaagagtccgacctgctggaa
gcgcaggcggcggaagccacctgggaggagctcaagctggcgttaccggagttgaatatc
ggcctggtacacggccgcatgaagcccgccgaaaaacaggcggtgatgcaggcctttaag
cagggtgaactgcatctgctggtcgccactacggtgattgaggtgggggtcgatgttcct
aactccagcctgatgattattgaaaacccggagcgactgggcctggcgcaattacaccag
ctcagaggacgcgttggccgtggcgcggtcgcgtcgcactgcgtgctgctctataaatcg
ccgttgtcgaaaacggcgcagaagcgtttacaggtattgcgcgacagcaacgacggcttt
gtgattgcacaaaaagatttagagattcgcggcccgggggaattactgggcacgcgccag
acgggtaacgccgaatttaaagtagctgatttgctgcgcgatcaagccatgatccccgaa
gttcagcgtattgcccgtcatattcacgaacgttatccacagcaggcacaagcgctgatt
gagcgctggatgccggaaaccgaacgttattccaacgcctaa

DBGET integrated database retrieval system