KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_20105
Entry
Q786_20105        CDS       T02944                                 

Definition
(GenBank) primosome assembly protein PriA
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Q786_20105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_20105
Enzymes [BR:sens01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Q786_20105
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Q786_20105
SSDB
Motif
Pfam: PriA_3primeBD PriA_C DEAD ResIII Helicase_C PriA_CRR AAA_30 TrwB_AAD_bind zinc-ribbons_6 AAA_19
Other DBs
NCBI-ProteinID: AHB46597
Position
complement(4195241..4197439)
AA seq 732 aa
MSVAHVALPVPLPRTFDYLLPEVGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDEL
KSVIEILDNEPIFSPSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFA
TEEGQAVDINSLKRSAKQQQALAALRQGKIWRYQVAELDFTDATLQTLRRKGLCELASET
PAFTDWRERYAVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLEN
VLAQGKQALVMVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIV
IGTRSSLFTPFKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPA
LETLCNVRQKKYRMLRLTRRAGNARPALQHVLDLKGQRLQAGLAPALIARMRQHLQADNQ
VILFLNRRGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCG
STHMLPVGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQ
MLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHH
PEHPLLQTLLYKGYDAFAEQALAERQTLQLPPWTSHVIIRAEDHNNQQAPVFLQQLRNLI
QASPLSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARK
VKWVLDVDPIEG
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtccgtcgcgcacgttgccttgcccgttccgcttccccgaacctttgattacctgctg
ccggaagtcggggtcgccaaagccgggtgccgcgtgcgcgtgccgttcggcaagcagcaa
gagcgcgtgggcattgtcgtctcggttagcgaccacagcgaattgccgctcgatgaatta
aaatcggtcattgaaatcctggataacgagccaatcttttctccctccatctggcgctta
ctcctctgggcggcggattactaccaccatcccctcggcgacgttctgtttcacgctctg
ccggttttactgcgtcagggaaaaccagccagcaacgcgcccctatggtattggttcgcc
accgaagaggggcaagccgtcgacatcaacagcctgaaacgctccgccaaacaacaacag
gcgctggcggcgctgcggcaaggaaagatctggcgctatcaggtagccgagcttgatttt
actgacgccacgctgcaaacgctgcggcgtaaggggctttgtgagcttgccagtgaaacg
cccgcgtttaccgactggcgggagcgttatgccgtcgcaggagagcgcctgcggctgaat
accgaacaggcgacagcggtcggcgcaattcacagcgcgtcggacggtttctccgcctgg
ttgctggcaggcgtaaccggttccggcaagaccgaagtgtatctgagtgtgctggaaaac
gtcctcgcccagggcaaacaggcgctggtgatggtgccggaaatcggcctgacgccgcaa
acgatcgcccgttttcgcgaacgttttaacgcgccggtggaagtgctgcattccgggcta
aacgacagcgagcgtctttcggcatggctgaaagcgaaaaacggcgaagcggcgattgtc
atcggcacgcgctcctcgctgtttacgccgtttaaaaatcttggcgtaattgtcatcgac
gaagagcacgacagctcttataaacagcaggaagggtggcgctaccatgcccgcgatttg
gcagtgtatcgcgcccatagcgagcagatcccgattattctcggctccgccaccccagcc
ctggaaacgctatgcaacgtgcggcagaaaaaataccggatgctgcgtctgacgcggcgc
gcaggcaacgcccgcccagccctgcagcatgtgctggatttaaaaggccagcgtcttcag
gcgggactggcgcccgcccttatcgcccgtatgcgccaacatctccaggccgacaatcag
gtaattttatttcttaaccgccggggattcgcgcccgcgctgctttgccacgactgcggc
tggattgcggagtgcccgcgttgcgatcactactacacgctgcaccaggcgcagcatcat
ttacgctgtcatcactgcgacagccagcgtccggtaccgcgtcagtgcccctcctgcggc
tccacacatatgctaccggttgggttagggaccgaacagctggaacaggtgctggcgccc
ttcttccccggcgtgccgatctcacgaatcgaccgtgataccaccagtcgtaaaggcgcg
ctggagcagcatctggcggaagttcaccgcggcggagcgcgcattctgataggcacacaa
atgctggcgaaaggccaccactttccggacgtcacgctggtggcgttgctggacgtcgat
ggcgcgcttttttccgcagattttcgttcggcggaacgcttcgcccagctctacactcag
gtttccggccgcgccgggcgcgcgggcaaacagggcgaagtggtgctccaaacgcaccat
cctgaacatcccctgctgcaaacgttactgtataaaggctatgatgcgtttgcggagcag
gcgctggcggaacggcaaacgctccagcttccgccatggaccagccacgtcattattcgc
gcagaggatcacaacaatcagcaggcgcccgtctttctccagcagttgcgtaatctgatt
caggccagcccgctatcagacgataagctgtggatcttaggtccggttccggccctcgcg
ccaaaacgcggcggccgctatcgctggcaaattttacttcagcatccttcacggattcgc
ctgcaacacatcatcagcggcacgctggcgttgatcaatacgctcccggaagcgcggaaa
gttaaatgggttctggacgtcgatccgattgaaggatag

DBGET integrated database retrieval system