KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_20880
Entry
Q786_20880        CDS       T02944                                 

Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03030  DNA replication
sens03430  Mismatch repair
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Q786_20880
   03430 Mismatch repair
    Q786_20880
   03440 Homologous recombination
    Q786_20880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sens03032]
    Q786_20880
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_20880
   03029 Mitochondrial biogenesis [BR:sens03029]
    Q786_20880
DNA replication proteins [BR:sens03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Q786_20880
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     Q786_20880
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Q786_20880
Mitochondrial biogenesis [BR:sens03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    Q786_20880
SSDB
Motif
Pfam: SSB tRNA_anti-codon
Other DBs
NCBI-ProteinID: AHB46734
Position
4361427..4361957
AA seq 176 aa
MASRGVNKVILVGNLGQDPEVRYMPSGGAVANLTLATSESWRDKQTGEMKEQTEWHRVVM
FGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQSGQERYTTEINVPQIGGVMQMLGGRQGG
GAPAGGQQQGGWGQPQQPQQPQGGNQFSGGAQSRPQQSAPAPSNEPPMDFDDDIPF
NT seq 531 nt   +upstreamnt  +downstreamnt
atggccagcagaggcgtaaacaaggtgattctcgttggtaatctgggccaggacccggaa
gtacgctatatgccgagtggcggcgctgtcgccaacttaacgctggctacttctgaatcc
tggcgcgataagcagaccggcgaaatgaaagagcagactgaatggcaccgggtggtgatg
ttcggcaaactggcggaagtggccggcgaatatctgcgtaaaggttctcaggtgtatatc
gaaggtcaattgcgtacccgcaagtggaccgatcagagtggccaggaacgctatacgact
gagattaacgttccgcagatcggcggcgtgatgcagatgctgggtggtcgccagggcggc
ggcgcgccggcaggcggtcagcagcaggggggttggggtcagccacaacaacctcagcag
ccgcagggcggcaaccagttcagcggcggcgcgcagtcgcgtccacagcaatccgcgcca
gcgccgtctaacgaaccgccaatggattttgacgacgacattccgttctga

DBGET integrated database retrieval system