KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_22505
Entry
Q786_22505        CDS       T02944                                 

Definition
(GenBank) primosomal protein DnaI
  KO
K02317  DNA replication protein DnaT
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sens00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Q786_22505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sens03400]
    Q786_22505
DNA repair and recombination proteins [BR:sens03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Q786_22505
SSDB
Motif
Pfam: DnaT
Other DBs
NCBI-ProteinID: AHB47035
Structure
PDB: 
6AEP 6AEQ

Position
complement(4708942..4709604)
AA seq 220 aa
MAVPQTPPRVIGGTPPAVLTGLCGTIKTVALLGCCSILRNIMSSRILTSDVIGIDALLHD
HHAVLAKSTGGAVAVFANNAPAFYAVTPARMAELLALEEKLSRPGSDVALDAQFYEEPEA
APVAIPCGKFAMYPAWQPDADFQRQAALWGVALREPVTAEELAAFIAYWQAEGKVFHHIQ
WQQKLARSVQISRSSNGGMPQRDINSVSEPDNHIPPGFRG
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctgtaccgcaaacgcccccgcgtgtgatcggtggaacgcctcctgctgttcttaca
ggtctgtgtggtactataaaaacagtcgcccttctcggttgttgttccatattgagaaac
attatgtcttccagaattttaacgtcggacgtcatcggtattgacgcccttttacacgat
catcatgctgtgctggcgaagtcaacgggcggcgcagtggcggtattcgctaataatgcg
cctgccttttatgccgtgacgcctgcacgcatggctgaactgctggcgcttgaagaaaag
ttatcacgtccgggaagcgatgtggcgttagacgcgcaattttacgaagaacccgaagcc
gcccccgttgcgattccctgcggaaaattcgccatgtatcccgcctggcaaccggatgcg
gattttcagcgtcaggctgccctttggggcgtggcgcttcgggagccggtcaccgcagaa
gagctggcggcgtttatcgcctactggcaggcggaaggtaaggtttttcaccatatccag
tggcagcaaaagctggcgcgcagcgtgcaaatcagccgttccagcaatggcggaatgccg
cagcgcgacatcaatagcgtcagcgaacctgacaatcatattccaccaggttttaggggg
taa

DBGET integrated database retrieval system