Staphylococcus epidermidis SEI: DP17_1290 Help Entry DP17_1290         CDS       T03343                                  Name (GenBank) NUDIX domain protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism seps  Staphylococcus epidermidis SEI Brite KEGG Orthology (KO) [BR:seps00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:seps03400]     DP17_1290 Enzymes [BR:seps01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      DP17_1290 DNA repair and recombination proteins [BR:seps03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     DP17_1290  Prokaryotic type     DP17_1290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_2 Nudt16-like Nodulin-like AlgF Motif Other DBs NCBI-ProteinID:  AIR83372 Position complement(1375780..1376163) Genome browser AA seq 127 aa AA seqDB search MIKKVAAIIIKDDCILSVSKKKAPDFYMLPGGKYEGSENDFEALSRELKEELNVNISEMN FFGDFEDISMLENEKLFLRIYITKIIGKPNPDNEIVNMKWISIYSNCNTKIGSGISKFVI PKLRGEL NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgataaaaaaagttgctgctatcattataaaagatgattgtattttatcggttagtaaa aaaaaagcaccagatttttatatgttaccaggaggaaagtatgaaggttcagaaaatgat tttgaagctttatctagggagctaaaagaagaattaaatgtgaatatttccgaaatgaat ttcttcggagattttgaagatatttctatgttagaaaatgaaaaattatttttaagaatc tatataacaaaaataattggtaaaccaaatccggataatgaaattgtaaatatgaaatgg atttctatatattcaaattgtaatacaaagataggaagtgggatttctaaatttgttatt ccaaaattaagaggcgaactttaa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (5) Pfam (5) All databases (7) Download RDF

DBGET integrated database retrieval system