KEGG   Streptomyces pratensis: Sfla_0162
Entry
Sfla_0162         CDS       T01647                                 
Name
(GenBank) Phytanoyl-CoA dioxygenase
  KO
K18565  2-oxoglutarate-dependent dioxygenase [EC:1.14.20.-]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00332  Carbapenem biosynthesis
sfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Sfla_0162
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.-
     Sfla_0162
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-ProteinID: ADW01630
UniProt: A0A8D3WCC3
Position
208724..209515
AA seq 263 aa
MRLGRPVEDIVRELDENGFAPLDDLVPESVLEVMRRGCDDLIGRTRQMRHSSQGWQLEAE
GDGGGWAARATGREGIPGKVRVVGYAHEHSPEIAKVPGLLGLNENLVEPLHGLRGDFYNS
YLWAKPSEVGSEKPWHQDALFLKEEFYEAYEDVFTIWIAVDDAREDNGCLRFLPGSHRGS
VLQEPRGINREDLFASPHEPSLDIETLWPELTPVTLPRRPGSAVIFSAFTAHTSSANVTE
DQRRAVSYVYSLPRRPGTTGAGR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcggctcggtcggccggtggaagacattgtccgcgaactggacgagaacgggttcgcc
ccgctcgacgatctcgtccccgaatcggtcctggaggtcatgcgccgcggctgcgacgac
ctgatcggccggacccggcagatgcgccacagcagtcagggctggcagctggaggccgag
ggggacggcggcggctgggcggcccgcgcgacgggcagggaaggaattccgggcaaggta
cgggtggtgggctatgcccatgaacactccccggagatcgccaaggtgcccggactgctc
ggcctgaacgagaacctggtcgagccgctgcacggtctgcgcggcgacttctacaacagc
tacctgtgggccaagccgtcggaggtgggttcggagaagccctggcaccaggacgcgctc
ttcctcaaggaggagttctacgaggcctacgaggacgtcttcaccatctggatcgccgtg
gacgacgcccgcgaggacaacggctgtctccgcttcctgccgggatcgcaccgcgggagc
gtcctgcaggagcctcgcggcatcaaccgtgaggacctcttcgcctccccgcacgaaccg
tccctggacatcgagacgctgtggcccgagctgactccggtcaccctccccaggcgcccc
ggttcggccgtgatcttcagtgcgttcaccgcgcacacctcctccgccaacgtcaccgag
gaccagcgacgtgccgtcagttacgtctactcgctgccacgccgccccggcaccacggga
gccgggcggtga

DBGET integrated database retrieval system