KEGG   Streptomyces fradiae: CP974_02875
Entry
CP974_02875       CDS       T07648                                 
Name
(GenBank) FAD-binding monooxygenase
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Organism
sfb  Streptomyces fradiae
Pathway
sfb00404  Staurosporine biosynthesis
sfb01100  Metabolic pathways
sfb01110  Biosynthesis of secondary metabolites
Module
sfb_M00805  Staurosporine biosynthesis, tryptophan => staurosporine
Brite
KEGG Orthology (KO) [BR:sfb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    CP974_02875
Enzymes [BR:sfb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-
     CP974_02875
SSDB
Motif
Pfam: FAD_binding_3 DAO Lycopene_cycl Pyr_redox_2 FAD_binding_2 NAD_binding_8 Pyr_redox Pyr_redox_3 HI0933_like
Other DBs
NCBI-ProteinID: QEV11125
Position
complement(667132..668769)
AA seq 545 aa
MTRSAEWTDVLIVGGGPVGLALALDLAYRGIDCTVAEAGDGTVRHPKVSTIGPRSMELLR
RWGVADAVRGAGWPSDHPLDIAWVTRVGGHEIHRYRRGTAGSRPAFAHTPEPDQMCPAHW
LNPVLTRAVGVHPDGPLRLRTTVERVRQADDHVEAALTDHSTGTTRTLRARYVVACDGAA
SPVRRACGIDAPARHRTQVFRNILFRAPELRERLGDRAALVHFLMLSATLRFPLRALNGT
DLYNLVVGVEDEAAGRADAAALVREALAFDTPVELLGDGEWRLTHRVADRYRAGRVFLAG
DAAHTLSPSGGFGLNTGIGDAADLGWKLAAALDGWAGRHLLDTYETERRPIAVESLEEAN
RNLRRTMSRRLPPGIAADGPEGERARAEVARRLEESGAWREFDAPEIHFGLGYRSPAIVE
DPAAPARPGKPDARWRPGSDPGYRAAHAWWDATTSTLDLFGRGYVLLCFAEDGEPAVVER
AFAERGVPLTVRSGGAEEVAKLYERSFVLVRPDGHVAWRGDALPRDAGALADIVRGERTQ
PVRDL
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgacacgttccgccgagtggaccgacgtactgatcgtgggcggcggcccggtcgggctg
gcgctcgccctcgacctggcgtaccgcgggatcgactgcacggtcgccgaggccggcgac
gggacggtccggcatcccaaggtcagcacgatcggcccccggtcgatggagctgctgcgc
cgctggggggtggccgacgccgtccgcggcgccggatggccgtccgaccaccccctggac
atcgcctgggtcaccagggtcggcggtcacgagatccaccgctaccgccggggcacggcc
ggaagccggccggccttcgcgcacacccccgagcccgaccagatgtgcccggcgcactgg
ctgaacccggtgctgacgcgcgccgtgggcgtgcaccccgacggcccgctgcggctccgc
acgaccgtcgagcgcgtgcggcaggccgacgaccacgtggaggccgccctcaccgaccac
tccaccggcaccacccgcaccctgcgggcccggtacgtggtggcctgcgacggcgccgcg
tcccccgtccggcgggcctgcggcatcgacgcgccggcgcgccaccgcacgcaggtcttc
cgcaacatcctcttccgcgcccccgagctgagggagcgcctcggcgaccgcgccgccctc
gtccacttcctgatgctctccgccacactgcgcttccccctgcgcgcgctgaacggcacc
gacctgtacaacctggtcgtgggcgtcgaggacgaggccgccgggcgcgccgacgcggcc
gccctggtccgcgaggccctggcgttcgacaccccggtggagctgctgggcgacggggag
tggcgcctcacccaccgcgtggccgaccgctaccgcgccgggcgggtcttcctcgccggg
gacgccgcgcacaccctctcgccgtccgggggcttcgggctcaacaccgggatcggcgac
gccgccgacctgggctggaagctcgccgcggcgctggacggctgggcggggcgccacctg
ctcgacacgtacgagaccgagcgccggccgatcgccgtggagagcctggaggaggccaac
cgcaacctgcggcggaccatgagccgccggctgccgcccggcatcgcagcggacggcccc
gagggcgagcgcgcccgcgcggaggtggcgcggcggctggaggagagcggggcgtggcgg
gagttcgacgccccggagatccacttcgggctgggctaccgatccccggcgatcgtcgag
gacccggcggcgcccgcccgcccggggaagccggacgcgcggtggcgccccggcagcgac
cccggttaccgggccgcgcacgcctggtgggacgccaccacctccacgctggacctgttc
gggcgcggatacgtgctgctgtgcttcgccgaggacggcgaaccggcggtcgtcgagcgc
gcgttcgccgagcgcggggtgccgctgaccgtgcggagcgggggagcggaggaggtcgcc
aagctctacgagcggtccttcgtgctggtccgtccggacggccacgtggcgtggcggggc
gacgccctgccccgcgacgcgggggccctcgccgacatcgtgcggggggagcggacccag
cccgtgcgagacctctga

DBGET integrated database retrieval system