KEGG   Streptomyces fradiae: CP974_27370
Entry
CP974_27370       CDS       T07648                                 
Name
(GenBank) L-glutamine:2-deoxy-scyllo-inosose aminotransferase
  KO
K13547  L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase [EC:2.6.1.100 2.6.1.101]
Organism
sfb  Streptomyces fradiae
Pathway
sfb00524  Neomycin, kanamycin and gentamicin biosynthesis
sfb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CP974_27370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfb01007]
    CP974_27370
Enzymes [BR:sfb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.100  L-glutamine:2-deoxy-scyllo-inosose aminotransferase
     CP974_27370
    2.6.1.101  L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase
     CP974_27370
Amino acid related enzymes [BR:sfb01007]
 Aminotransferase (transaminase)
  Others
   CP974_27370
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: QEV15071
Position
complement(6240318..6241592)
AA seq 424 aa
MVSPLAVKGGEALRTRPWPAWPQPAPGVPAAVAEVLGSGRWSISGPYRGTDSHERRFARA
FADYHGVPYCVPAASGTAGLMLALEACGVGAGDEVIVPGLSWVASGSTVLGVNAVPVFCD
VDPDTLCVSPEAVEALITERTRAVVVVHLYSAVADMDGLTRVAERHGLPLVEDCAQAHGA
SYRGVKVGALATAGTFSMQHSKVLTSGEGGAVITRDADLARRVEHLRADGRCLSDGPPAP
GAMELVETGELMGSNRCLSEFQAAILTEQLTLLDEQNRTRRANAARLDGLLGELGLRPQA
TSEGTTSRTYYTYAARLPEGALEDVPLTDVTGALTAELGFPVQPCYAPIPANRLYAPQTR
RRYTLGPDHEARIDPKRFALPVCEDTARRTVTLHHAALLGDAEDMADIAAAFAKVLRHGA
DLAT
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggtctccccgttggcagtgaagggcggcgaggcgttacgcacccgcccctggcccgcc
tggccgcagcccgcccccggagtccccgccgcggtggcggaggtgctcggctcgggccgg
tggtccatcagcggcccgtaccgcggcacggactcccacgagcggcgcttcgcgcgggcg
ttcgccgactaccacggcgtgccgtactgcgtccccgccgcgagcggcaccgccggcctg
atgctggccctggaggcgtgcggggtcggcgccggcgacgaggtgatcgtccccggcctg
tcctgggtcgcctccggctccaccgtcctgggcgtcaacgccgtcccggtcttctgcgac
gtcgacccggacacgctgtgcgtctcccccgaggccgtcgaagcgctgatcaccgagcgg
accagggccgtcgtggtggtccacctctactcggccgtcgcggacatggacggcctcacc
cgcgtcgccgagcgccacggcctgcccctcgtcgaggactgcgcccaggcccacggggcc
tcctaccggggcgtcaaggtcggtgcgctggccaccgccggcaccttcagcatgcagcac
agcaaggtgctcaccagcggcgagggcggcgcggtcatcacccgcgacgcggacctcgcc
cgccgggtcgagcacctgcgggccgacggccgctgcctgtccgacggcccgcccgcgccg
ggcgccatggagctggtcgagaccggcgagctgatgggcagcaaccgctgcctgtccgag
ttccaggccgccatcctcaccgagcagctcaccctgctcgacgagcagaaccgcacccgc
cgcgccaacgccgcccgcctcgacggcctcctcggcgagctgggcctgcgcccccaggcg
acctccgagggcaccacctcccgtacgtactacacctacgcggcgcggctccccgagggc
gcgctggaggacgtcccgctcaccgacgtcaccggcgccctcaccgccgagctcggcttc
cccgtccagccctgctacgccccgatcccggcgaaccggctgtacgccccgcagacccgc
aggcgctacacgctcggcccggaccacgaggcgcgcatcgaccccaagcgcttcgccctc
ccggtgtgcgaggacaccgcgcggcggaccgtcaccctgcaccacgccgccctgctcggc
gacgccgaggacatggccgacatcgccgcggccttcgcgaaggtcctgcggcacggcgcc
gacctggccacttga

DBGET integrated database retrieval system