KEGG   Sinorhizobium fredii USDA 257: USDA257_c31490
Entry
USDA257_c31490    CDS       T02188                                 

Name
(GenBank) hypothetical protein
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfd02000]
    USDA257_c31490
Transporters [BR:sfd02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   USDA257_c31490
SSDB
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: AFL51717
UniProt: I3X761
Position
complement(3299336..3300139)
AA seq 267 aa
MVLLRQGAHAGARRHRTVSGGTESAPLSRPERDRHRALHRRGTTRDLACGGRSETREMMT
ALLFAKGLLLGLAIAAPLGPIGTLCISRTLERGFWAGVAGGLGTALADATYALMAAAGFA
AFATFLSTLSVPLGLVGGAFMLWLGWRGLKPRPVAAAAVIGARDLLHMTTATFLLTMANP
TTILTFAAIFAGFGLAAVGDGMSAAIVVAGVFLGSLGWWLLLSGGIALAKTRLPDGFAAW
TSRISGLVLIAFGLAALASAALNLAEF
NT seq 804 nt   +upstreamnt  +downstreamnt
atggtcctattgcgccaaggtgcgcatgccggcgctcggcgacatcgaaccgtttctggc
ggaactgaaagcgcgccgctatctcgcccggagcgagaccgtcatcgcgctctccaccgc
cgcggaacgacccgtgaccttgcctgcggcggacgaagcgaaacgagggagatgatgacc
gcattgctttttgcaaaaggactgcttctcgggcttgccattgccgcgccgcttggaccg
atcggcacgctttgcatcagccgcacgctcgaacgcggtttctgggccggcgtcgcaggc
ggtctcgggacggcgcttgccgacgcgacctacgcgttgatggcggccgcgggcttcgcg
gcttttgcgacgtttctctcgacgctttcggttcccctcgggctcgtcggcggtgccttc
atgctgtggctcggctggcgcggattgaagccccggccggttgcggcggcggccgtaatc
ggcgcccgtgatctgttgcacatgacgactgcgacgttcctcctgacgatggcgaacccg
accaccatcctgaccttcgccgccatctttgcgggcttcggcctcgccgccgttggtgat
ggaatgagcgcggcgatcgttgtcgctggtgtcttcctcggatcactcggctggtggttg
ctcctgagcggcggtatcgccctcgccaagaccaggctgcctgacggttttgccgcctgg
acctcgcgcatttccgggctcgtcctcatcgctttcggcctggccgctcttgcttcggct
gcgctcaacttggccgagttctaa

DBGET integrated database retrieval system