KEGG   Streptococcus ferus: NCTC12278_01789
Entry
NCTC12278_01789   CDS       T07132                                 

Symbol
sacB
Name
(GenBank) beta-D-fructosyltransferase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
sfer  Streptococcus ferus
Pathway
sfer00500  Starch and sucrose metabolism
sfer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCTC12278_01789 (sacB)
Enzymes [BR:sfer01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     NCTC12278_01789 (sacB)
SSDB
Motif
Pfam: Glyco_hydro_68 Otopetrin Glyco_hyd_101C HSP70
Other DBs
NCBI-ProteinID: SQF41190
UniProt: A0A2X3VII1
Position
1:complement(1721124..1722716)
AA seq 530 aa
MVNWNGYQLVVAMMGIPNTNDNHIYLLYNKYGDNNFDHWKNAGPIFGFNADGVTQQWSGS
ATLNDDGSIQLYYTKVDTSDNNSNNQRLATATLYLGYDAENVKILSVENDKLLTPGGGDG
YYYQSYSQWRSTFTGADNIAMRDPHVIEDDNGDRYLVFEASTGLQNYQGEDQIYHFSNYG
GDTAYKVKSLFRFLENDDMYSRASWSNAAIGILKLKGDHKTPEVDQFYTPLLSSPMVSDE
IERPNVVKLGDKYYLFAASRLNHGSNTDAWNKTNQIVGDNVIMLGYVSDSLTGGYLPLNG
NGAVLTASVPADWRTATYSYYAVPVEGSSDTLLITAYMTNRNEVAGKGNNSTWAPSFLIQ
VFPDGTTKVLAEMTQQGDWIWDETSRTTATMGTLDTAYLPGENDGYIDWNTIGGYGLKPH
APSQYQPKAPSPSEETETLEVTFNISIDGKLTIKHSRGEETSPSERTVSGTIRQSNQSDQ
KTKARTEKTDTASKKEKASKKKASTHVASALKALFAGILSFLASLFTFKS
NT seq 1593 nt   +upstreamnt  +downstreamnt
gtggtcaactggaatggttaccaattagtggttgctatgatggggatcccaaatacaaat
gataaccatatttatctgctttataataaatatggggataataactttgatcattggaag
aatgccggtccaatctttggcttcaatgctgacggggtcacacaacaatggtcgggttct
gcaacgctcaatgatgatggctccattcagctgtattacactaaggtagataccagtgac
aataacagcaataatcagcgccttgcaacggctacactttacctcggttatgatgctgaa
aatgtcaaaatcctttctgttgaaaacgacaaattgctgacaccaggcggaggggatggt
tactactaccaaagttacagccagtggcggtcaacctttacaggtgcagacaatattgcc
atgcgcgacccgcatgttatcgaagatgacaatggcgaccgttatcttgtctttgaggca
agcacagggcttcagaattatcagggagaagaccagatctatcatttctccaactatggt
ggagatactgcttataaggttaaaagtctctttagattccttgaaaatgacgatatgtat
agtcgtgccagctggtctaatgcggctattggtattctcaaactgaaaggagatcacaaa
actccggaagtagaccaattctatacaccattactcagctcaccgatggtttctgatgaa
attgagcgtccaaatgtggttaaactgggagataagtactatctttttgcggcttcacgt
cttaaccatggcagcaacacggatgcttggaataaaaccaatcagatcgttggagacaat
gtcatcatgttgggttatgtctccgacagcttgactggtggctatctgccacttaatggc
aatggagctgtactgactgcttctgtcccggcagattggcggacggcgacctactcgtac
tatgctgtacctgttgaggggtcttcggatactctgctgatcacagcctacatgaccaat
cgtaacgaggtcgcaggtaagggcaataattcgacttgggctccaagtttccttatccaa
gtttttccagatggtaccactaaagttctggcagaaatgactcagcagggggattggatt
tgggatgaaacaagccgtacaacagctacaatgggaacgcttgataccgcctaccttcca
ggggaaaatgatggctatattgattggaatacgataggaggctatggcctgaaaccacat
gctccaagtcaataccaaccaaaagcgccaagtccatcagaagagacagaaactctagaa
gtaacctttaatatctctattgatggcaagctgaccattaaacacagcagaggcgaggag
acatctccttctgaaaggactgtttctggaactatccgtcagtcaaatcaatcggatcag
aagactaaggcaaggaccgaaaagactgatactgcctctaaaaaggagaaagcaagcaag
aagaaagcctcaactcatgtggcatctgccttaaaggctttgtttgcaggtatcttgtct
ttcctagcttcgctctttacctttaaatcataa

DBGET integrated database retrieval system