KEGG   Sinorhizobium fredii HH103: SFHH103_06007
Entry
SFHH103_06007     CDS       T01731                                 

Name
(GenBank) Putative amino acid efflux protein
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
sfh  Sinorhizobium fredii HH103
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfh02000]
    SFHH103_06007
Transporters [BR:sfh02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SFHH103_06007
SSDB
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: CCF00467
UniProt: G9AHD5
Position
pSfHH103e:1248471..1249097
AA seq 208 aa
MTALLFAKGLLLGLAIAAPLGPIGTLCISRTLERGFWAGVAGGLGTALADATYAMMAAAG
FAAFATFLSTLSVPLGLVGGVFMLWLGWRGLRPRPIAAPAEIGARDLLHTTTATFLLTMA
NPTTILTFAAIFAGLGLAAVGDGVSATIVVAGVFLGSLGWWFVLSGGVTLARTRLPDGFA
AWTSRLSGLLLIAFGLAALASAAAGLAE
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaccgcgttgctcttcgcaaagggactgctcctcgggcttgccatcgccgcaccgctc
ggcccgatcggcacgctttgcatcagccgtacgctggaacgcggtttctgggccggcgtc
gcaggcggtctcgggacggcgcttgccgatgcaacttacgcgatgatggcggcggctggc
tttgcggcgtttgcgacgtttctctcgacgctttcggttccgctcggcctcgtcggcggt
gtcttcatgctttggctcggctggcgcggattgaggccacggccgattgcggcgccagcc
gagatcggcgcgcgcgacctgctgcacacgacgaccgcgaccttcctgctgaccatggcg
aacccgaccacgatcctgaccttcgccgcgatctttgcgggcctcggcctcgccgccgtc
ggcgatggagtgagcgcgacgatcgtcgtcgccggggtcttcctcgggtcgctcggctgg
tggtttgtcttgagcggcggcgtcacgctcgcgaggaccaggctgcctgacggttttgcc
gcctggacgtcgcgtctttccggcctcctcctgatcgccttcggcctggccgccctcgcc
tcggcggctgccggtttggccgagtaa

DBGET integrated database retrieval system