KEGG   Streptomyces ficellus: EIZ62_04025
Entry
EIZ62_04025       CDS       T06929                                 

Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
sfic  Streptomyces ficellus
Pathway
sfic00523  Polyketide sugar unit biosynthesis
sfic01100  Metabolic pathways
sfic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfic00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    EIZ62_04025
Enzymes [BR:sfic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     EIZ62_04025
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 Ubie_methyltran MetW FtsJ CMAS NodS DUF938 TPMT Pox_MCEL
Other DBs
NCBI-ProteinID: QGV82453
UniProt: A0A6I6FEI5
Position
924955..925677
AA seq 240 aa
MYDRADIYEAIYRGRGKDYAAESAVTVRAVLDRKPDATSLLDVACGTGSHLRYFSERFAH
VEGVDLSDDMVRTARTKVPGVPIHQGDMRDLRLERSFSAVTCMFSSVGYLATTAELDAAL
RSFARHLTPGGVAVVEPWWSPDTFLPGYVAGNVVEVDGRTISRVSHTVRHDEHCVSRMEV
HYVVAEPEHGIQHFTDTHVMTLFTREQYEHAFRAAGLSVEFVPYDQAGPGLFVGVLGADR
NT seq 723 nt   +upstreamnt  +downstreamnt
ctgtacgacagggccgacatctacgaggcgatctaccgcgggcgcggcaaggactacgcg
gccgagtcggccgtcaccgtccgggccgtcctcgaccggaagcccgacgcgacatccctg
ctggacgtcgcctgcggcaccggatcccatctgcggtacttctccgagcggttcgcccac
gtcgagggcgtcgacctgtcggacgacatggtgcgtaccgcacggaccaaggtgcccggc
gtcccgatccaccagggcgacatgcgcgacctccggctggaacgttccttctccgccgtc
acctgcatgttcagctccgtgggctacctggcgacgaccgcggagctggacgcggcgctg
cgctccttcgcccggcacctgacgcccggcggagtggccgtcgtcgagccgtggtggtcc
cccgacaccttcctgccgggctacgtggccgggaacgtggtcgaggtcgacgggcggacg
atctcccgcgtctcgcacaccgtgcgccacgacgagcactgtgtgagccggatggaggtg
cactacgtggtcgccgaaccggagcacggcatccagcacttcaccgacacgcacgtgatg
acgctgttcacccgcgagcagtacgagcacgcgttccgcgccgccgggctgtccgtggag
ttcgtgccgtacgaccaggccggccccgggctgttcgtcggcgtgctcggcgcggaccga
tga

DBGET integrated database retrieval system