KEGG   Streptomyces galilaeus: CP966_29020
Entry
CP966_29020       CDS       T06932                                 

Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
sgal  Streptomyces galilaeus
Pathway
sgal00523  Polyketide sugar unit biosynthesis
sgal01100  Metabolic pathways
sgal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgal00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CP966_29020
Enzymes [BR:sgal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     CP966_29020
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 NNMT_PNMT_TEMT Ribosomal_S5 NodS
Other DBs
NCBI-ProteinID: QEU68862
UniProt: A0A5J6EY67
Position
6343520..6344236
AA seq 238 aa
MYGRELADVYEAIYRSRGKDWGQEAADVSRIITERRPGADSLLDVACGTGAHLSVFSTLF
EVAEGLEIAEPMRRLAEQRLPGTTVHAGDMRDFRLPRTYTAVSCMFCAIGYLETLDDMRA
AVRSMAAHLEPGGVLVVEPWWFPENFIEGYVAGDLAREEHRTIARISHTTRKGRATRMEV
RFTVGDAAGIQQFTEIDVLTLFTRDEYTAAFTDAGCSVEFLEDGPTGRGLFVGVREQH
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtacggccgggaactcgcggacgtgtacgaggccatctaccgcagccgcggcaaggac
tggggacaggaggcggcggacgtctcgcggatcatcaccgaacggcgtccgggagccgat
tcgctgctcgacgtcgcctgtggcacgggcgcccatctgagcgtgttcagcaccctgttc
gaggtcgccgagggcctggagatcgcggagccgatgcggcggctcgccgagcagcggctg
cccggcaccaccgtgcacgccggcgacatgcgcgacttccggctcccgcgcacctacacg
gcggtgagctgcatgttctgcgccatcggctacctggagacgctggacgacatgcgggcc
gcggtccgctcgatggccgcccatctggagcccggcggcgtgctggtcgtcgaaccctgg
tggttcccggagaacttcatcgagggctatgtcgcgggtgacctggcccgcgaggagcac
cggaccatcgcccggatctcgcacaccacccggaagggccgggccacccgcatggaggtt
cgcttcaccgtgggggacgccgccggcatccagcagttcacggagatcgacgtgctgacc
cttttcaccagggacgaatacacggccgcgttcaccgacgccggttgttccgtcgaattc
ctggaggacggacccaccggccgcggtcttttcgtcggtgtccgcgaacagcactga

DBGET integrated database retrieval system