KEGG   Streptomyces globisporus: WQO_33775
Entry
WQO_33775         CDS       T04209                                 

Definition
(GenBank) dTDP-4-dehydro-6-deoxyglucose aminotransferase
  KO
K21326  aminotransferase
Organism
sgb  Streptomyces globisporus
Pathway
sgb00523  Polyketide sugar unit biosynthesis
sgb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    WQO_33775
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ALU98423
UniProt: A0A0U3BNK3
Position
SGLP1:complement(28691..29923)
AA seq 410 aa
MSGGPVRLDSLPTPYFSEPLHVGRPNVGSRDRLMERIDGALERLWFTNDGPLVREFEARV
AELTQVRHCVAVSNATTGIQVAAKALGIGPGDEVIVPSFTWVATAHALDWIGAVPVFCEL
DEETGTADVAHVERLIGPRTRAILDVHVFGRPARIDELTKLAAEHGLHLLFDAAHAFGCT
YRSKPIGGFGTAEIFSFQATKFVNSFEGGAIVTDDDALADRLRAMRHQGLNAAHEITGSG
TVARMHEISAAMGLTSLESADHFTAINRRNYRLYEQYLDGLPGVRVRPQDPNELSNCQYV
VIEVDAVRAGLHRDELQAVLQRHNVLARAYFSPGCHSCEPYRSDLARHAPDPLPKVEALT
ERVLSLPTGTAVGPEEVRGVCRILRAAVDGSAVPEIHESTEGDAGGRPAR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgagcggcggcccggtgcgtctggactccctacccacgccctacttcagcgaaccgctg
cacgtgggacgcccgaacgtgggctcccgcgaccgtttgatggaacggatcgacggggcg
ctggagcgcctgtggttcaccaatgacggccccctggtccgggagttcgaggcccgtgtg
gccgagctgacccaggtcaggcactgcgtcgccgtatcgaacgccaccaccggcatccag
gtcgccgcgaaggccctgggcatcggtcctggggacgaggtgatcgtgccctccttcacc
tgggtcgccaccgcccacgcactggactggatcggtgcggtgcctgtcttctgcgaactg
gacgaggagaccggaaccgcggacgtggcacacgtggagcggctcatcggcccgcgtacc
cgcgccatcctggacgtgcacgtcttcggcagaccggcccggatcgacgagctgaccaag
ctggccgccgagcacgggctgcacctgctcttcgatgccgcccacgccttcggctgcacc
taccggtcgaagccgatcggcggcttcggcacggcggagatcttcagcttccaggcgacg
aagttcgtgaacagcttcgagggcggggcgatcgtcaccgacgacgacgccctggccgac
cggctccgggccatgcgccaccaggggctcaacgccgcgcatgagatcaccgggagcgga
acggtcgcgcggatgcacgagatcagcgcggccatgggcctcacctccctggagtccgcc
gatcacttcaccgcgatcaaccggcgcaactaccgtctgtacgagcagtacctcgacgga
ctgcccggcgtccgggtccgcccgcaggatccgaacgagctgtcgaactgccagtacgtc
gtcatcgaggtggacgccgtccgcgccgggctgcaccgcgacgaactccaggcggtgctc
caacggcacaacgtcctggcccgcgcctacttcagccccggctgccacagctgcgagccc
taccggtccgacctcgcgcgccacgcgcccgatccgctcccgaaggtggaggcgctcacc
gagcgggtgctgtcgctgcccaccggtacggcggtggggccggaggaggtgcggggggtc
tgccgcattctgcgggcggccgtcgacgggagtgccgtgccggaaatccacgagagcaca
gagggagatgcaggcggccgtccggcgaggtga

DBGET integrated database retrieval system