KEGG   Streptomyces globisporus: WQO_33780
Entry
WQO_33780         CDS       T04209                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K21327  N-methyltransferase [EC:2.1.1.-]
Organism
sgb  Streptomyces globisporus
Pathway
sgb00523  Polyketide sugar unit biosynthesis
sgb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    WQO_33780
Enzymes [BR:sgb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     WQO_33780
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 NodS Methyltransf_2 Ubie_methyltran
Other DBs
NCBI-ProteinID: ALU98424
UniProt: A0A0U3LRU7
Position
SGLP1:complement(29920..30654)
AA seq 244 aa
MEYGPEHAKFYDLVFRSRGKDFDLEARGLTELILAARPDAVSLLDVACGTGAHLETLATL
FGHVEGLEYAPAMLEQAAGRLPGVPLHAGDMRSFDLGRTFDAITCMGNALGEMGSVTELK
AAVSAMAHHLNPGGVLVAEPWYFPENFLDGHVGGHLHQEEGRVITRMTHSVRQGDKSRLE
VRFRVADASGFREFSEVLTSSLFTREQYTDAFESVGLSVRFVPGFRLADGRPNSPGLFVG
VRTA
NT seq 735 nt   +upstreamnt  +downstreamnt
atggagtacggccccgagcacgcgaagttctacgacctcgtgttccgcagccgcggcaag
gacttcgacctggaggcccgcgggctcaccgagctgatcctcgccgcccgccccgacgcc
gtgtcgctcctggacgtcgcctgcggcaccggagcccatctggagacgctcgccacgctc
ttcggccatgtggagggcctcgagtacgcgcccgcgatgctggagcaggcggcgggccgg
cttcccggcgtcccgctgcacgccggtgacatgcgttcgttcgacctgggccgcaccttc
gacgcgatcacctgcatgggcaacgcgctcggcgagatggggtccgtcaccgagctcaag
gccgcggtgtcggccatggcccaccacctgaaccccgggggagtcctcgtcgccgaaccc
tggtatttccccgagaacttcctcgacgggcatgtcggcggccatctgcaccaggaggag
ggccgtgtcatcacgcggatgacgcactccgtgcgccagggcgacaagtcacgtctggag
gtccggttccgggtcgcggacgcctccggcttcagagagttctccgaggtcctgacctcc
agcctcttcacccgcgagcagtacaccgacgccttcgaatcggtggggctctcggtgcgg
ttcgtgcccggcttccggctggccgacggccggcccaacagccccggcctcttcgtcggc
gtgcgcacggcatga

DBGET integrated database retrieval system