Streptomyces griseoaurantiacus: V9K83_09830 Help Entry V9K83_09830       CDS       T10677                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sgrs  Streptomyces griseoaurantiacus Pathway sgrs00190   Oxidative phosphorylation sgrs01100   Metabolic pathways Module sgrs_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sgrs00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     V9K83_09830 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sgrs00194]     V9K83_09830 (atpE) Photosynthesis proteins [BR:sgrs00194]  Photosystem and electron transport system   F-type ATPase [OT]    V9K83_09830 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WWY84483 Position complement(2318201..2318425) Genome browser AA seq 74 aa AA seqDB search MSQTLAAVDGSLSSVGYGLAAIGPGVGIGIIFGNGTQALARQPEAAGLIRANQILGFAFC EALALIGLVMPFVY NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtcccagacccttgctgccgttgacggttccctcagctcggtcggctatggcctggcc gccatcggccccggcgtcggcatcggcatcatcttcggcaacggcacccaggcgctggcc cgtcagcccgaggccgccggtctgatccgcgccaaccagatcctcggcttcgccttctgt gaggcgctggccctcatcggcctggtcatgccgttcgtctactag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (1) Pfam (1) All databases (2) Download RDF

DBGET integrated database retrieval system