Shewanella sp. MR-4: Shewmr4_0467 Help Entry Shewmr4_0467      CDS       T00388                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism she  Shewanella sp. MR-4 Brite KEGG Orthology (KO) [BR:she00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:she03400]     Shewmr4_0467 Enzymes [BR:she01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      Shewmr4_0467 DNA repair and recombination proteins [BR:she03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     Shewmr4_0467  Prokaryotic type     Shewmr4_0467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Nudt16-like NUDIX_4 NUDIX_2 Motif Other DBs NCBI-ProteinID:  ABI37547 Position 529716..530123 Genome browser AA seq 135 aa AA seqDB search MAFEDRFRLSSHGVITNDAGQVLLLKANYGNCAWGLPGGALEPGETIHEALLRECQEELG LAVNVHYLSGVYYHSTYQSQAFIFRCEFASADAVIRLSHEHSEFAFHDIDTLSAVQQQRV KDCLNFNGVVVSAKF NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcatttgaagataggtttcggctcagtagccatggggtgatcactaacgatgcaggc caagtgttactccttaaggcaaattacggcaattgcgcctggggcttacccggcggcgcc ttagagcccggtgaaacgattcacgaagccctgctgcgcgaatgccaagaggaactgggg ctggcggtgaacgtccactacctaagcggcgtgtattatcacagcacctatcaatcccaa gcttttatctttcgttgtgagtttgcatctgccgacgccgtgattcgcttaagccatgaa cactcagagtttgccttccatgatatcgacacacttagcgcggtccagcagcaaagagtt aaagattgtcttaatttcaacggtgttgtcgtgagtgcaaagttttaa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system