KEGG   Setaria italica (foxtail millet): 101761949
Entry
101761949         CDS       T02818                                 

Name
(RefSeq) cytochrome P450 93G1-like
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00941  Flavonoid biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101761949
   00943 Isoflavonoid biosynthesis
    101761949
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sita00199]
    101761949
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     101761949
Cytochrome P450 [BR:sita00199]
 Cytochrome P450, plant type
  CYP93 family
   101761949
SSDB
Motif
Pfam: p450 RepB
Other DBs
NCBI-GeneID: 101761949
NCBI-ProteinID: XP_022684345
Position
VII:complement(531883..533876)
AA seq 539 aa
MLVVSMEEHPMGAVVLALIIAAVAAVSLQHLISRRASRRLPPGPTSLPVIGHLHLLRPPV
HRTFQELAARVGPLMHIRLGSTHCVVASTAEVASELIRSHEGSISERPLTAVARQFAYGS
AGFAFAPYNTHWRFMKRLCMSELLGPRTVEHLRPVRRAGTVSLLRAALAAASSPAAEPFD
LTRELIRLSNTSIIRMVASTVPGSVADEAQELVKDVAELVGAFNADDYIALCRGWDLQGL
RRRAAAVHRRFDALLEEILRHKEDAREARKLLMLDDDGDDGRKKEAATATMHKDLLDILM
DKAEDKTAEVKLTRDNIKAFIIDVVTAGSDTSAAMVEWMLAELMNHPEALRNVVAEIDAV
VGGDRIAGEADLPRLPYLIAAYKETLRLHPAAPIAHRQSSEEMQLRGFTVPPQTAVFINI
WAIGRDPAFWEEPLAFRPERFMPGGAAESLEPRGQHFHFMPFGSGRRGCPGMGLALQSVP
AVLAALVQCFDWATAGGGDDDGVKGMPIDMDESDGLVCARKHPLLLRPTPRLNPFPAVV
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgctggtggtgagcatggaagagcatccaatgggcgccgtagtcctggcgctcattatt
gcggccgtcgccgccgtgtccttgcagcacctcatctcccggcgagcctcccgtcgtctt
ccccctggcccgactagcctcccagtgatcgggcacctccacctgctccggccgccggtg
caccgcaccttccaggagctggctgcccgggtggggcccctgatgcacatccgcctgggg
tccacgcactgcgtcgtggcgagcaccgcggaggtggcgagcgagctgatccgcagccac
gaggggagcatctcggagcggccgctcacggcggtggcccggcagttcgcctacggctcc
gccggcttcgccttcgccccctacaacacccactggcgcttcatgaagcgcctctgcatg
tcggagctcctcggaccccgcaccgtcgagcacctccgccccgtccgtcgcgccggcacc
gtgtccctgctgcgggccgcgctggcggcggcctcctcgccggcggccgaacccttcgac
ctcacccgcgagctcatccgcctctccaacacctccatcatccgcatggtcgccagcacc
gtgccggggagcgtcgcggacgaggcgcaggagctcgtcaaggacgtggcggagctcgtc
ggcgccttcaacgccgacgactacatcgccctctgccgcggctgggacctgcagggcctc
cgccggcgagccgccgccgtccaccgccgcttcgacgcgctgctcgaggagatactcagg
cacaaggaggacgccagggaggcgaggaaactcctcatgctcgacgacgacggcgacgac
ggcaggaagaaggaggccgcgacggcgacgatgcacaaggacctgcttgacatcctcatg
gacaaagccgaggacaagacggcggaggtcaagctcacacgggacaacatcaaggccttc
atcatcgacgtggtcactgctggttcggacacgtcggcggccatggtggagtggatgctg
gcggaattgatgaaccacccggaggccctgcgcaacgtggtggcggagatcgacgccgtc
gtcggcggggaccggatcgccggcgaggcggacctgccgcggctgccatacctgattgcg
gcgtacaaggagacgctgcggctgcacccggcggcgcccatcgcgcaccgccagtcgtcg
gaggagatgcagctccgagggttcaccgtgccgccgcagaccgccgtgttcatcaacatc
tgggccatcggccgcgacccggcattctgggaggagcccctggcgttccgcccggagcgg
ttcatgcctggcggcgccgccgagagcctggagccccgcgggcagcacttccacttcatg
cccttcggcagcggccgccgcggatgccccggcatgggcctcgcgctgcagtccgtgccg
gccgtgctggcggcgctcgtgcagtgcttcgactgggccaccgctggcggcggcgacgac
gacggggtcaagggcatgccgatagacatggatgagtcggacggcctggtgtgcgctcgc
aagcacccgctcctgctccgccccacgcctcgcctcaaccccttcccggccgtcgtctag

DBGET integrated database retrieval system