KEGG   Streptomyces kanamyceticus: CP970_02280
Entry
CP970_02280       CDS       T06849                                 

Name
(GenBank) hypothetical protein
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CP970_02280
Enzymes [BR:ska01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     CP970_02280
SSDB
Other DBs
NCBI-ProteinID: QEU89901
UniProt: E9KTB6
Position
575980..576978
AA seq 332 aa
MSAPVAAPYCRFEKIGSPDLEDDETVLGVIEHGTGHTGASLVDGVPRTALHTTTRDEEAF
AEVWHAEPPVESGTDDGIAWARTGEYLFGVGRVPESRRYADAVSALYTRLFGLTRSLGYP
LLARTWNYVSGINSANADGLEVYRDFCVGRAQALDEGGIDPASMPAATGIGTHGGGIACA
FIAARGGVRVNIENPAVLTAHHYPAAYGPRSPVFARATWVGPPDGGRLFVSATAGILGHE
TTHHGDVTGQCEVALDNIARVVGAENLRRHGIRRGHVLADVDHLKVYVRRREDLAAVRRV
CAARLSSTATVAILHTDIARGDLLVEIEGVVR
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtctgcgcccgtcgcggcaccgtactgccgcttcgagaagatcgggtcgccggacctc
gaagacgacgagacggtactcggcgtcatcgaacacggcaccggccataccggggcgtcg
ctggtggacggcgtcccgcgaaccgccttgcacaccacgacccgtgacgaggaggcgttc
gccgaggtctggcacgcggagccgcccgtcgagtccggtacggacgacggcatcgcgtgg
gcccgcaccggcgagtacctgttcggtgtggggcgcgtccccgagagccgcaggtacgcc
gatgccgtctcggcgctctacacgcgcctcttcgggctgacccggtcgctgggatacccg
ctgctcgcccgtacgtggaactacgtcagcggcatcaactcggcgaacgcggacggcctc
gaggtgtaccgggacttctgcgtgggccgcgcccaggcgctcgacgagggcggcatcgac
ccggcgagcatgcccgcggccaccggcatcggcacgcacgggggcggcatcgcctgcgcg
ttcatcgcggcccgcggcggggtccgggtcaacatcgagaaccccgccgtcctcacggca
caccactaccccgcggcatacggcccgcgctccccggtcttcgcgcgggccacctgggtg
ggcccgccggacggtggccggctgttcgtttccgcgacggccggcattctcggacacgag
acgacgcaccacggtgacgtgaccggtcagtgcgaggtcgccctggacaacatcgcccgg
gtcgtcggcgcggagaacctgcgccgccacgggatccggcgggggcacgtcctcgccgac
gtcgaccacctcaaggtctacgtccgccgccgcgaggacctcgcggcggtgcgccgcgtc
tgcgccgcccgcctgtcgagcaccgcgaccgtcgcgatattgcacaccgacatcgcccgc
ggcgacctgctcgtcgaaatcgagggggtggtgcggtga

DBGET integrated database retrieval system